Property Summary

NCBI Gene PubMed Count 36
Grant Count 15
R01 Count 11
Funding $1,096,225.33
PubMed Score 38.05
PubTator Score 24.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (12)

PMID Text
22728643 Both MRG15 CD and Pf1 PHD1 bind to their targets with >100 muM affinity.
21466675 While the present study expands on the role of MRG15 in the control of genomic stability, weak associations can not be ruled out for potential low-penetrance variants at MORF4L1 and breast cancer risk among BRCA2 mutation carriers
20844547 it seems unlikely that any constitutional changes in MRG15 confer an increased risk for breast cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332121 gene deficiency reduces DNA repair and increase sensitivity to DNA-crosslinking agents
19553677 MRG15 is a novel PALB2-interacting factor involved in homologous recombination
17573780 RBP2 associates with MRG15 complex to maintain reduced H3K4 methylation at transcribed regions, which may ensure the transcriptional elongation state
17460191 MORF4 has a role in cellular aging, and MRG15 associates with both histone deacetylases and histone acetyl transferase complexes [review]
17135209 The MRG15 chromo domain may function as an adaptor module which can bind to a modified histone H3 in a mode different from that of the HP1/Pc chromo domains.
17008723 identify MRG15 residues that form a shallow hydrophobic pocket to interact with the N-terminal 50 residues of PAM14 through primarily hydrophobic interactions
More...

AA Sequence

MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRSEKSLKTHEDI      1 - 70
VALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGL     71 - 140
QQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDD    141 - 210
WDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQ    211 - 280
YAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDY    281 - 350
EVAPPEYHRKAV                                                              351 - 362
//

Text Mined References (41)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22728643 2012 Sequence requirements for combinatorial recognition of histone H3 by the MRG15 and Pf1 subunits of the Rpd3S/Sin3S corepressor complex.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21466675 2011 Exploring the link between MORF4L1 and risk of breast cancer.
21378988 2011 A genome-wide association study in Europeans and South Asians identifies five new loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
20844547 2010 Mutation analysis of the gene encoding the PALB2-binding protein MRG15 in BRCA1/2-negative breast cancer families.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332121 2010 MRG15 binds directly to PALB2 and stimulates homology-directed repair of chromosomal breaks.
19650074 2009 p8/nupr1 regulates DNA-repair activity after double-strand gamma irradiation-induced DNA damage.
More...