Property Summary

NCBI Gene PubMed Count 36
PubMed Score 39.18
PubTator Score 24.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma, Adenoid Cystic 99 0.0 0.0
Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 3.0

Expression

Gene RIF (12)

AA Sequence

MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRSEKSLKTHEDI      1 - 70
VALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGL     71 - 140
QQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDD    141 - 210
WDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQ    211 - 280
YAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDY    281 - 350
EVAPPEYHRKAV                                                              351 - 362
//

Text Mined References (41)

PMID Year Title