Property Summary

NCBI Gene PubMed Count 35
PubMed Score 80.42
PubTator Score 43.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 1.813 6.9e-05
adult high grade glioma 1.300 6.7e-03
astrocytoma 1.100 4.3e-09
colon cancer 1.200 9.6e-03
ductal carcinoma in situ 1.700 4.8e-04
esophageal adenocarcinoma 1.100 2.1e-02
glioblastoma 1.800 1.2e-07
group 3 medulloblastoma 2.300 2.6e-05
intraductal papillary-mucinous carcinoma... 1.500 2.4e-03
intraductal papillary-mucinous neoplasm ... 1.400 6.4e-03
invasive ductal carcinoma 2.000 1.8e-04
lung cancer 2.000 1.3e-02
malignant mesothelioma 2.200 2.6e-07
medulloblastoma, large-cell 1.800 7.9e-06
Multiple myeloma 1.641 2.0e-03
nasopharyngeal carcinoma 1.300 3.5e-05
non-small cell lung cancer 1.677 1.0e-20
oligodendroglioma 1.200 1.3e-08
ovarian cancer 1.500 2.6e-04
primary Sjogren syndrome 1.100 4.6e-03
primitive neuroectodermal tumor 1.800 7.0e-04
psoriasis 1.200 1.1e-45

 GO Component (2)

 MGI Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (20)

AA Sequence

MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKD      1 - 70
LGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPHPSHDGSSFKSPDTVCLSRGK     71 - 140
LLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIEQKKKELYLLKKSSTSVRDGGKRVGSGAQKT    141 - 210
RTGRLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGG    211 - 280
TSIQLQLKEKKKKGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKR    281 - 350
IKYSVGSLSPVSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPS    351 - 420
NELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASV    421 - 490
HVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQEHLTVQAKAPFHTPPEEPNE    491 - 560
CDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRTEFITQEENRICSSPVQSLLDLFQTSEEKSE    561 - 630
FLGFTSYTEKSGICNVLDIWEEENSDNLLTAFFSSPSTSTFTGF                              631 - 674
//

Text Mined References (47)

PMID Year Title