Property Summary

NCBI Gene PubMed Count 33
Grant Count 84
R01 Count 65
Funding $6,026,038.94
PubMed Score 73.45
PubTator Score 43.73

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UBU7 A4D1D8 A8K954 O75226 Q75MS6 Q75N01 Q9Y2M6
Symbols ASK
CHIF
DBF4A
ZDBF1

Gene

PDB

4F99   4F9A   4F9B   4F9C  

 GO Component (1)

Gene RIF (18)

PMID Text
24287290 The anti-invasive and cell cycle arrest-inducing effects of nitrogen-containing bisphosphonates are not DBF4 mediated in human breast cancer cells.
22123827 Dbf4 is direct downstream target of ataxia telangiectasia mutated (ATM) and ataxia telangiectasia and Rad3-related (ATR) protein to regulate intra-S-phase checkpoint.
21536671 bipartite interaction between Cdc7 and Dbf4/ASK subunits facilitates ATP binding and substrate recognition by the Cdc7 kinase.
21036905 Dbf4 regulates the Cdc5 Polo-like kinase through a distinct non-canonical binding interaction
19864417 The interaction with LEDGF relieves autoinhibition of Cdc7-ASK kinase, imposed by the C terminus of ASK.
19744312 Data document the role of DBF4 as a key player in nitrogen-containing bisphosphonate-induced cytotoxicity, thus explaining the effects on the cell-cycle.
19111665 These results indicate that Ddk functions as an upstream regulator to monitor S-phase checkpoint signaling.
18714392 increased Cdc7-Dbf4 abundance may be a common occurrence in human malignancies
18536724 A strong origin of replication at the DBF4 promoter locus, which contains two initiation zones, two origin recognition complex (ORC) binding sites and two DNase I-hypersensitive regions, is identified.
18503552 ASK/Dbf4, a novel cell survival gene in melanoma is transcriptionally regulated by E2F1.
More...

AA Sequence

MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKD      1 - 70
LGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPHPSHDGSSFKSPDTVCLSRGK     71 - 140
LLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIEQKKKELYLLKKSSTSVRDGGKRVGSGAQKT    141 - 210
RTGRLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGG    211 - 280
TSIQLQLKEKKKKGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKR    281 - 350
IKYSVGSLSPVSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPS    351 - 420
NELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASV    421 - 490
HVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQEHLTVQAKAPFHTPPEEPNE    491 - 560
CDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRTEFITQEENRICSSPVQSLLDLFQTSEEKSE    561 - 630
FLGFTSYTEKSGICNVLDIWEEENSDNLLTAFFSSPSTSTFTGF                              631 - 674
//

Text Mined References (45)

PMID Year Title
24287290 2014 The cell cycle arrest and the anti-invasive effects of nitrogen-containing bisphosphonates are not mediated by DBF4 in breast cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22123827 2012 Dbf4 is direct downstream target of ataxia telangiectasia mutated (ATM) and ataxia telangiectasia and Rad3-related (ATR) protein to regulate intra-S-phase checkpoint.
21536671 2011 Molecular mechanism of activation of human Cdc7 kinase: bipartite interaction with Dbf4/activator of S phase kinase (ASK) activation subunit stimulates ATP binding and substrate recognition.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21036905 2010 Dbf4 regulates the Cdc5 Polo-like kinase through a distinct non-canonical binding interaction.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19864417 2010 Transcriptional co-activator LEDGF interacts with Cdc7-activator of S-phase kinase (ASK) and stimulates its enzymatic activity.
19744312 2009 Identification of secondary targets of N-containing bisphosphonates in mammalian cells via parallel competition analysis of the barcoded yeast deletion collection.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...