Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.89
PubTator Score 4.31

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer -1.100 2.0e-03
malignant mesothelioma -1.300 1.3e-06
ovarian cancer -1.700 8.3e-07
pancreatic ductal adenocarcinoma liver m... -1.143 3.0e-02
psoriasis 1.100 1.9e-03
ulcerative colitis -1.123 3.8e-02

Synonym

Accession Q9UBU6 B2R725
Symbols AHCP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAEGPEEARGHPPGQDDGGGDHEPVPSLRGPPTTAVPCPRDDPQAEPQAPGRPTAPGLAAAAAADKLEPP      1 - 70
RELRKRGEAASGSGAELQEQAGCEAPEAAAPRERPARLSAREYSRQVHEWLWQSYCGYLTWHSGLAAFPA     71 - 140
YCSPQPSPQSFPSGGAAVPQAAAPPPPQLGYYNPFYFLSPGAAGPDPRTAAGISTPAPVAGLGPRAPHVQ    141 - 210
ASVRATPVTRVGSAAPSRSPSETGRQAGREYVIPSLAHRFMAEMVDFFILFFIKATIVLSIMHLSGIKDI    211 - 280
SKFAMHYIIEEIDEDTSMEDLQKMMVVALIYRLLVCFYEIICIWGAGGATPGKFLLGLRVVTCDTSVLIA    281 - 350
PSRVLVIPSSNVSITTSTIRALIKNFSIASFFPAFITLLFFQHNRTAYDIVAGTIVVKRNGVR           351 - 413
//

Text Mined References (11)

PMID Year Title