Property Summary

NCBI Gene PubMed Count 740
Grant Count 882
R01 Count 474
Funding $89,847,682.82
PubMed Score 4732.22
PubTator Score 574.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Synonym

Gene

PDB

1P7X  

Gene RIF (719)

PMID Text
26904686 The concentrations of gastric peptide(Ghrelin and obestatin)and adipocytokines(omentin and Apelin ) across all subgroups were lower than in the control group. The differences were statistically significant (p < 0.0001), which may be of importance in the development of the disease complications
26741958 GH, IGF-1 and ISI-Matsuda index were lower in the high fatty liver index group in obese subjects with fatty liver and sarcopenia.
26721207 High serum ghrelin may be protective against the development of hypertension.
26643495 Our study provides the first preliminary evidence suggesting that oxidative stress may affect fetal ghrelin levels in humans.
26599409 the GHRL rs26311 polymorphism is associated with an increased risk to hepatitis B virus-related liver cirrhosis, especially in men.
26536003 Preproghrelin Leu72Met variation is on the exon 2 with a cytosine (C) to adenine (A) transition at base 408 (+408C>A). Previous studies indicated that this variation was associated with obesity, early onset of obesity and metabolic syndrome.
26506614 Among the gastroesophageal reflux disease patients, ghrelin levels were inversely associated with the frequency and severity of acid regurgitation
26407611 Ghrelin modulates GLUT1 expression and thus indirectly enhances tumor cell proliferation. These findings are of major relevance, because glucose uptake is assumed to be a promising target for cancer treatment.
26402983 low serum ghrelin concentrations associated with increased global cardiovascular risk
26396004 Higher levels of ghrelin were associated with an increased risk of Barrett's esophagus among the general population.
More...

AA Sequence

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAED      1 - 70
ELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK                            71 - 117
//

Text Mined References (741)

PMID Year Title
26904686 2016 Assessment of Serum Concentrations of Ghrelin, Obestatin, Omentin-1, and Apelin in Children with Type 1 Diabetes.
26792793 2016 Multi-species sequence comparison reveals conservation of ghrelin gene-derived splice variants encoding a truncated ghrelin peptide.
26741958 2016 Fatty Liver Index Associates with Relative Sarcopenia and GH/ IGF- 1 Status in Obese Subjects.
26721207 2016 Serum ghrelin and prediction of metabolic parameters in over 20-year follow-up.
26643495 2015 Perinatal Oxidative Stress May Affect Fetal Ghrelin Levels in Humans.
26599409 2015 Association of Ghrelin Gene Polymorphisms and Serum Ghrelin Levels with the Risk of Hepatitis B Virus-Related Liver Diseases in a Chinese Population.
26536003 2015 Associations of Leu72Met Polymorphism of Preproghrelin with Ratios of Plasma Lipids Are Diversified by a High-Carbohydrate Diet in Healthy Chinese Adolescents.
26506614 2015 Associations of Circulating Gut Hormone and Adipocytokine Levels with the Spectrum of Gastroesophageal Reflux Disease.
26407611 2016 Ghrelin promotes oral tumor cell proliferation by modifying GLUT1 expression.
26402983 Serum ghrelin level is associated with cardiovascular risk score.
More...