Property Summary

Ligand Count 42
NCBI Gene PubMed Count 773
PubMed Score 5052.48
PubTator Score 574.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (752)

AA Sequence

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAED      1 - 70
ELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK                            71 - 117
//

Text Mined References (774)

PMID Year Title