Property Summary

NCBI Gene PubMed Count 31
Grant Count 6
R01 Count 6
Funding $663,696.99
PubMed Score 37.50
PubTator Score 30.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.700 0.000
cutaneous lupus erythematosus -1.300 0.018
glioblastoma -1.800 0.002
Atopic dermatitis -2.800 0.000
non-small cell lung cancer -1.916 0.000
sarcoidosis 1.400 0.033
lung adenocarcinoma -1.100 0.000
pediatric high grade glioma -1.500 0.003
group 4 medulloblastoma -2.200 0.000
pilocytic astrocytoma -1.400 0.009
invasive ductal carcinoma -1.177 0.014
lung carcinoma -1.400 0.000
ovarian cancer 2.000 0.022
pituitary cancer -1.100 0.002

Gene RIF (21)

PMID Text
25312721 Data indicate that inhibiting dickkopf-related protein 2 (DKK2)with siDKK2 reduced the expression of DKK2, but had no effect on leptin expression.
24117450 We found 1 DKK2 SNP to be significantly associated with alcohol-related harm in alcoholic subjects
23999978 MiR-21 overexpression was significantly correlated with the DKK2-/beta-catenin- immunohistochemical phenotype.
23587485 a new regulatory mechanism of miR-222
23204234 Our results provide strong evidence that DKK2 is a key player in Ewing sarcoma invasion and osteolysis and also in the differential phenotype of Ewing sarcoma cells.
22964660 DKK2 may contribute to tumorigenesis in epithelial ovarian cancer(EOC) through the Wnt/beta-catenin signaling mechanisms.
21540552 there are distinct functions of DKK1 and DKK2 in controlling angiogenesis
21312269 Elevated TGF-beta1 levels in osteoarthritic osteoblasts can stimulate DKK2 expression.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332099 In the study of the genetics of alcoholism, three SNPs in DKK2 (rs427983; rs419558; rs399087) demonstrated empirical significance.
More...

AA Sequence

MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGK      1 - 70
NLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIP     71 - 140
ALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQ    141 - 210
GEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI                         211 - 259
//

Text Mined References (33)

PMID Year Title
25312721 2014 Hypoxia and vitamin D differently contribute to leptin and dickkopf-related protein 2 production in human osteoarthritic subchondral bone osteoblasts.
24478790 2013 Genome wide association and linkage analyses identified three loci-4q25, 17q23.2, and 10q11.21-associated with variation in leukocyte telomere length: the Long Life Family Study.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24117450 2014 Association study of DKK2 polymorphisms with alcohol dependence and alcohol-related harm.
23999978 2014 MicroRNA-21 promotes oral cancer invasion via the Wnt/?-catenin pathway by targeting DKK2.
23587485 2013 MicroRNA-222 promotes tumorigenesis via targeting DKK2 and activating the Wnt/?-catenin signaling pathway.
23204234 2013 DKK2 mediates osteolysis, invasiveness, and metastatic spread in Ewing sarcoma.
22964660 2012 Epigenetic silencing of DKK2 and Wnt signal pathway components in human ovarian carcinoma.
21540552 2011 The WNT antagonist Dickkopf2 promotes angiogenesis in rodent and human endothelial cells.
21312269 2011 Elevated Dickkopf-2 levels contribute to the abnormal phenotype of human osteoarthritic osteoblasts.
More...