Property Summary

NCBI Gene PubMed Count 38
PubMed Score 41.86
PubTator Score 30.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.400 1.8e-02
Astrocytoma, Pilocytic -1.400 1.2e-02
Atopic dermatitis -2.800 2.7e-04
cutaneous lupus erythematosus -1.300 1.8e-02
glioblastoma -1.700 1.3e-05
group 3 medulloblastoma -1.900 1.5e-02
invasive ductal carcinoma -1.177 1.4e-02
lung adenocarcinoma -1.100 1.7e-07
lung carcinoma -1.400 2.5e-13
non-small cell lung cancer -1.916 1.1e-11
ovarian cancer 2.000 2.2e-02
pituitary cancer -1.100 2.0e-03
psoriasis -1.700 3.2e-05
sarcoidosis 1.400 3.3e-02

Gene RIF (28)

AA Sequence

MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGK      1 - 70
NLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIP     71 - 140
ALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQ    141 - 210
GEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI                         211 - 259
//

Text Mined References (40)

PMID Year Title