Property Summary

NCBI Gene PubMed Count 25
PubMed Score 12.37
PubTator Score 11.17

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.88126259878355E-15
ovarian cancer 8492 1.36793403771776E-11
lung adenocarcinoma 2714 3.43297652746028E-11
posterior fossa group B ependymoma 1530 2.82286539717258E-7
tuberculosis 1563 8.30002637503773E-6
pituitary cancer 1972 3.3873047983026E-5
pancreatic carcinoma 567 2.3418397112942E-4
pancreatic cancer 2300 2.34183971129434E-4
atypical teratoid/rhabdoid tumor 1095 4.15686405357218E-4
ductal carcinoma in situ 1745 0.00347307087987118
invasive ductal carcinoma 2950 0.00548489988899616
group 3 medulloblastoma 2254 0.00728587520941865
chronic rhinosinusitis 512 0.0118248952315566
glioblastoma 5572 0.0211423506941348
Disease Target Count Z-score Confidence
Riley-Day syndrome 8 3.249 1.6


  Differential Expression (14)

Disease log2 FC p
pancreatic cancer 1.100 0.000
posterior fossa group B ependymoma 1.300 0.000
glioblastoma 1.100 0.021
tuberculosis -1.600 0.000
non-small cell lung cancer -1.309 0.000
lung adenocarcinoma -1.900 0.000
atypical teratoid/rhabdoid tumor 1.200 0.000
group 3 medulloblastoma 1.200 0.007
pancreatic carcinoma 1.100 0.000
invasive ductal carcinoma -1.500 0.005
ductal carcinoma in situ -1.100 0.003
ovarian cancer -2.800 0.000
pituitary cancer 1.100 0.000
chronic rhinosinusitis -1.046 0.012

Gene RIF (16)

25793618 Alpha-catulin contributes to drug-resistance of melanoma by activating NF-kappaB and AP-1
23047866 our study shows that alpha-catulin plays a critical role in cancer metastasis
22733455 findings show that alpha-catulin is highly expressed in melanoma cells; expression of alpha-catulin promoted melanoma progression and occurred concomitantly with the downregulation of E-cadherin and the upregulation of expression of mesenchymal genes
22648798 these results strongly indicate that alpha-catulin contributes to the invasive behavior of metastatic cells and may be used as a prognostic marker and future therapeutic target for patients with cancer.
22359570 a robust transcriptional CTNNAL1 up-regulation occurs during acute ozone-induced stress and is mediated at least in part by ozone-induced recruitments of LEF-1 and AP-2alpha to the human CTNNAL1 promoter
21278790 Study provides evidence that alpha-catulin promotes tumor growth by preventing cellular senescence and suggests that downregulating alpha-catulin may be a promising therapeutic approach for cancer treatment.
21115837 Data show that alpha-dystrobrevin-1 recruits alpha-catulin, which supersensitizes alpha(1D)-AR functional responses by recruiting effector molecules to the signalosome.
20696764 the Lbc/alpha-catulin axis participates in 5-HT-induced PASMC mitogenesis and RhoA/ROCK signaling, and may be an interventional target in diseases involving vascular smooth muscle remodeling.
20677014 Observational study of gene-disease association. (HuGE Navigator)
18374411 Seven placental transcripts characterize HELLP-syndrome.

AA Sequence

VQLLSLCYKLLKKLQMENNGWVSVTNKDTMDSKT                                        701 - 734

Text Mined References (29)

PMID Year Title
25793618 2015 Alpha-catulin contributes to drug-resistance of melanoma by activating NF-?B and AP-1.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23047866 2013 ?-Catulin drives metastasis by activating ILK and driving an ?v?3 integrin signaling axis.
22733455 2013 ?-Catulin downregulates E-cadherin and promotes melanoma progression and invasion.
22648798 2012 ?-Catulin marks the invasion front of squamous cell carcinoma and is important for tumor cell metastasis.
22359570 2012 Identification of transcription factors regulating CTNNAL1 expression in human bronchial epithelial cells.
21278790 2011 ?-Catulin knockdown induces senescence in cancer cells.
21115837 2010 Alpha-dystrobrevin-1 recruits alpha-catulin to the alpha1D-adrenergic receptor/dystrophin-associated protein complex signalosome.
20696764 2010 The Lbc Rho guanine nucleotide exchange factor ?-catulin axis functions in serotonin-induced vascular smooth muscle cell mitogenesis and RhoA/ROCK activation.