Property Summary

NCBI Gene PubMed Count 80
PubMed Score 256.32
PubTator Score 142.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis and chronic rhinosinusit... 1.187 7.7e-04
juvenile dermatomyositis 1.159 6.8e-10
osteosarcoma 1.601 1.5e-02
ovarian cancer -2.200 3.4e-10
Pick disease 1.100 8.2e-03
primitive neuroectodermal tumor 1.100 1.7e-04
Rheumatoid arthritis 1.100 3.3e-02

 GO Component (2)

PDB (14)

Gene RIF (65)

AA Sequence

MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQ      1 - 70
KAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSN     71 - 140
YHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEE    141 - 210
RQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQIL    211 - 280
QNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLP    281 - 350
IRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVER    351 - 420
TFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKE    421 - 490
LLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLQAGNQALSATECTLEKTDKDKFVKPLE    491 - 560
MSHKKSFFDKKRSERKWSHQDTFKCEAVNKQSFQTSQPFQVLKKKMNENLEISENSDDCQILTCPVCFRA    561 - 630
QGCISLEALNKHVDECLDGPSISENFKMFSCSHVSATKVNKKENVPASSLCEKQDYEAHPKIKEISSVDC    631 - 700
IALVDTIDNSSKAESIDALSNKHSKEECSSLPSKSFNIEHCHQNSSSTVSLENEDVGSFRQEYRQPYLCE    701 - 770
VKTGQALVCPVCNVEQKTSDLTLFNVHVDVCLNKSFIQELRKDKFNPVNQPKESSRSTGSSSGVQKAVTR    771 - 840
TKRPGLMTKYSTSKKIKPNNPKHTLDIFFK                                            841 - 870
//

Text Mined References (81)

PMID Year Title