Property Summary

NCBI Gene PubMed Count 71
PubMed Score 249.79
PubTator Score 142.11

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Malignant neoplasm of prostate 67
Disease Target Count P-value
ovarian cancer 8492 3.36577104229091E-10
juvenile dermatomyositis 1189 6.81205282289155E-10
primitive neuroectodermal tumor 3031 1.66098968632583E-4
cystic fibrosis and chronic rhinosinusitis 213 7.6796614313905E-4
Pick disease 1893 0.00821941051220282
osteosarcoma 7933 0.0147474637709538
Rheumatoid Arthritis 1171 0.0334492001988052
Disease Target Count Z-score Confidence
Brain compression 4 3.79 1.9
Cholinergic urticaria 5 3.477 1.7
Disease Target Count
Malignant tumor of prostate 26


  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.033
osteosarcoma 1.601 0.015
primitive neuroectodermal tumor 1.100 0.000
juvenile dermatomyositis 1.159 0.000
Pick disease 1.100 0.008
ovarian cancer -2.200 0.000
cystic fibrosis and chronic rhinosinusit... 1.187 0.001



4GK5   2LSI   4BA9   1T94   2OH2   2W7O   2W7P   3IN5   3PZP   4U6P   4U7C  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
588579 confirmatory 2159 / 5211 / 396841 qHTS for Inhibitors of Polymerase Kappa
588638 summary 0 / 0 / 0 qHTS for Inhibitors of Polymerase Kappa: Summary
720501 confirmatory 696 / 223 / 0 qHTS for Inhibitors of Polymerase Kappa: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (57)

26765445 POLK protein polymorphisms may influence the risk of developing breast cancer among Chinese women.
26046662 Somatic Mutations in Catalytic Core of POLK Reported in Prostate Cancer Alter Translesion DNA Synthesis
26031400 POLK not only protects cells from genotoxic DNA lesions via DNA polymerase activities, but also contributes to genome integrity by acting as a non-catalytic protein against oxidative damage caused by hydrogen peroxide and menadione.
25899385 The structural dynamics of DinB1 changes upon substrate binding, noncognate DNA damage prevents the formation of the active conformation of DINB1.
25684709 The steric gate is crucial for rNTP discrimination because of its role in specifically promoting a dNTP-induced conformational change and that rNTP discrimination occurs in a relatively closed state of the polymerases.
25294835 The study shows that the Werner syndrome protein stimulates the 8-oxo-dG bypass activity of hpol kappa in vitro by enhancing the correct base insertion opposite the lesion, as well as extension from dC:8-oxo-dG base pairs.
25148552 role of the unique Polkappa gap and N-clasp structural features in the fidelity of minor groove lesion processing with extensive molecular modeling and molecular dynamics simulations to pinpoint their functioning in lesion bypass
25080294 The molecular mechanism of 3-nitrobenzanthrone genotoxicity in HEK293 cells is reported.
25065501 A slow conformational change after the nucleotidyl transfer is the rate-limiting step for hpol kappa catalysis.
24948471 polymorphism of POLK, an important gene in TLS, participates in platinum-chemotherapy tolerance and side-effect

AA Sequence

TKRPGLMTKYSTSKKIKPNNPKHTLDIFFK                                            841 - 870

Text Mined References (72)

PMID Year Title
26765445 2016 Association Between Single Nucleotide Polymorphisms in DNA Polymerase Kappa Gene and Breast Cancer Risk in Chinese Han Population: A STROBE-Compliant Observational Study.
26046662 2015 Somatic Mutations in Catalytic Core of POLK Reported in Prostate Cancer Alter Translesion DNA Synthesis.
26031400 2015 Catalytic and non-catalytic roles of DNA polymerase ? in the protection of human cells against genotoxic stresses.
25899385 2015 Noncognate DNA damage prevents the formation of the active conformation of the Y-family DNA polymerases DinB and DNA polymerase ?.
25684709 2015 Steric gate residues of Y-family DNA polymerases DinB and pol kappa are crucial for dNTP-induced conformational change.
25294835 2014 The Werner syndrome protein limits the error-prone 8-oxo-dG lesion bypass activity of human DNA polymerase kappa.
25148552 2014 Structural and dynamic characterization of polymerase ?'s minor groove lesion processing reveals how adduct topology impacts fidelity.
25080294 2014 Mutational analysis of the C8-guanine adduct of the environmental carcinogen 3-nitrobenzanthrone in human cells: critical roles of DNA polymerases ? and ? and Rev1 in error-prone translesion synthesis.
25065501 2014 Elucidation of kinetic mechanisms of human translesion DNA polymerase ? using tryptophan mutants.
24948471 2014 Association of POLK polymorphisms with platinum-based chemotherapy response and severe toxicity in non-small cell lung cancer patients.