Property Summary

NCBI Gene PubMed Count 6
Grant Count 15
R01 Count 11
Funding $1,811,171.03
PubMed Score 115.50
PubTator Score 267.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.253 0.016
posterior fossa group A ependymoma 1.500 0.000
glioblastoma 1.200 0.000
active Crohn's disease 1.039 0.016
pediatric high grade glioma 1.100 0.000
group 3 medulloblastoma 1.200 0.012
ductal carcinoma in situ 1.300 0.002
invasive ductal carcinoma 1.600 0.002
ovarian cancer -1.400 0.000
psoriasis 1.100 0.000

Gene RIF (1)

PMID Text
25668491 neurons have abnormal development due to lack of SUCO, which may be a generalized-onset epilepsy-related gene

AA Sequence

MKKHRRALALVSCLFLCSLVWLPSWRVCCKESSSASASSYYSQDDNCALENEDVQFQKKDEREGPINAES      1 - 70
LGKSGSNLPISPKEHKLKDDSIVDVQNTESKKLSPPVVETLPTVDLHEESSNAVVDSETVENISSSSTSE     71 - 140
ITPISKLDEIEKSGTIPIAKPSETEQSETDCDVGEALDASAPIEQPSFVSPPDSLVGQHIENVSSSHGKG    141 - 210
KITKSEFESKVSASEQGGGDPKSALNASDNLKNESSDYTKPGDIDPTSVASPKDPEDIPTFDEWKKKVME    211 - 280
VEKEKSQSMHASSNGGSHATKKVQKNRNNYASVECGAKILAANPEAKSTSAILIENMDLYMLNPCSTKIW    281 - 350
FVIELCEPIQVKQLDIANYELFSSTPKDFLVSISDRYPTNKWIKLGTFHGRDERNVQSFPLDEQMYAKYV    351 - 420
KMFIKYIKVELLSHFGSEHFCPLSLIRVFGTSMVEEYEEIADSQYHSERQELFDEDYDYPLDYNTGEDKS    421 - 490
SKNLLGSATNAILNMVNIAANILGAKTEDLTEGNKSISENATATAAPKMPESTPVSTPVPSPEYVTTEVH    491 - 560
THDMEPSTPDTPKESPIVQLVQEEEEEASPSTVTLLGSGEQEDESSPWFESETQIFCSELTTICCISSFS    561 - 630
EYIYKWCSVRVALYRQRSRTALSKGKDYLVLAQPPLLLPAESVDVSVLQPLSGELENTNIEREAETVVLG    631 - 700
DLSSSMHQDDLVNHTVDAVELEPSHSQTLSQSLLLDITPEINPLPKIEVSESVEYEAGHIPSPVIPQESS    701 - 770
VEIDNETEQKSESFSSIEKPSITYETNKVNELMDNIIKEDVNSMQIFTKLSETIVPPINTATVPDNEDGE    771 - 840
AKMNIADTAKQTLISVVDSSSLPEVKEEEQSPEDALLRGLQRTATDFYAELQNSTDLGYANGNLVHGSNQ    841 - 910
KESVFMRLNNRIKALEVNMSLSGRYLEELSQRYRKQMEEMQKAFNKTIVKLQNTSRIAEEQDQRQTEAIQ    911 - 980
LLQAQLTNMTQLVSNLSATVAELKREVSDRQSYLVISLVLCVVLGLMLCMQRCRNTSQFDGDYISKLPKS    981 - 1050
NQYPSPKRCFSSYDDMNLKRRTSFPLMRSKSLQLTGKEVDPNDLYIVEPLKFSPEKKKKRCKYKIEKIET   1051 - 1120
IKPEEPLHPIANGDIKGRKPFTNQRDFSNMGEVYHSSYKGPPSEGSSETSSQSEESYFCGISACTSLCNG   1121 - 1190
QSQKTKTEKRALKRRRSKVQDQGKLIKTLIQTKSGSLPSLHDIIKGNKEITVGTFGVTAVSGHI         1191 - 1254
//

Text Mined References (10)

PMID Year Title
25668491 2015 Exome sequencing identifies SUCO mutations in mesial temporal lobe epilepsy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20440000 2010 Osteopotentia regulates osteoblast maturation, bone formation, and skeletal integrity in mice.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11158380 2001 Global patterns of human DNA sequence variation in a 10-kb region on chromosome 1.
10673381 2000 The C1orf9 gene encodes a putative transmembrane member of a novel protein family.