Property Summary

NCBI Gene PubMed Count 21
Grant Count 4
Funding $4,350,879
PubMed Score 12.54
PubTator Score 13.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.100 0.003
hepatocellular carcinoma 1.200 0.000
astrocytic glioma -1.500 0.018
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.500 0.001
aldosterone-producing adenoma -1.035 0.044
ovarian cancer 1.600 0.000

Synonym

Accession Q9UBS8 A0AV26 A6NMR2 A8MTW5 B3KN72 B7ZLV2 D3DQE4 O94793 Q6IBV0
Symbols ARA54
HFB30
TRIAD2
HRIHFB2038

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
23449499 Ring Finger Protein 14 (RNF14) is a binding partner for all TCF/LEF transcription factors.
17919607 Differential localization of ARA54 may play an important role in testicular development and spermatogenesis in humans.
17510080 mRNA expression of ARA54 correlates with that of cyclin D1 in human colon carcinoma cells, indicating that ARA54 is not only involved in the regulation of cyclin D1 expression in cultured cell lines but also in clinical cancer specimens.
17110431 Dual functional roles for ARA54 as an AR coregulator directly and as a mediator for the suppressive effect of hnRNP A1 indirectly.
17082327 ARA54, might have dual in vivo roles functioning as both a direct coactivator and as an indirect mediator in AR function.
12772188 ARA54 role in prostate carcinoma progression may in may involve function as androgen receptor coactivator and focal adhesion protein
11673464 dominant-negative AR coregulator can suppress AR transactivation and cell proliferation in prostate cancer cells

AA Sequence

MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFL      1 - 70
PPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNI     71 - 140
VSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQI    141 - 210
KCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVK    211 - 280
ELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPC    281 - 350
KVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKM    351 - 420
TCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED                    421 - 474
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23449499 2013 Ring Finger Protein 14 is a new regulator of TCF/?-catenin-mediated transcription and colon cancer cell survival.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19345326 2009 Regulation of androgen receptor transcriptional activity and specificity by RNF6-induced ubiquitination.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17919607 2008 Expression of androgen receptor co-regulators in the testes of men with azoospermia.
17510080 2007 ARA54 is involved in transcriptional regulation of the cyclin D1 gene in human cancer cells.
More...