Property Summary

Ligand Count 4
NCBI Gene PubMed Count 119
PubMed Score 258.98
PubTator Score 344.88

Knowledge Summary

Patent (1,223)

TINX Plot

  Disease (6)

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.400 7.7e-07
Astrocytoma, Pilocytic 1.200 1.8e-06
atypical teratoid / rhabdoid tumor -3.100 3.5e-07
ependymoma -2.700 1.7e-16
glioblastoma -1.900 2.4e-06
group 3 medulloblastoma -3.500 2.0e-05
intraductal papillary-mucinous carcinoma... -1.100 7.4e-04
intraductal papillary-mucinous neoplasm ... -1.100 7.9e-03
lung cancer -1.800 2.2e-04
medulloblastoma, large-cell -3.700 9.5e-08
osteosarcoma -2.535 2.1e-05
Pick disease -1.500 6.2e-04
primitive neuroectodermal tumor -1.500 9.2e-04
psoriasis -2.700 8.4e-05
subependymal giant cell astrocytoma -3.477 1.4e-02
tuberculosis 2.000 2.5e-07
Waldenstrons macroglobulinemia -1.031 6.0e-03

Gene RIF (86)

AA Sequence

MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGE      1 - 70
REVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGS     71 - 140
SRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYE    141 - 210
LKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRF    211 - 280
PTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVP    281 - 350
VKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVE    351 - 420
GHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGR    421 - 490
SGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDL    491 - 560
SWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLN    561 - 630
NLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKE    631 - 700
WRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWL    701 - 770
GIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLA    771 - 840
IVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVS    841 - 910
ELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK                       911 - 961
//

Text Mined References (119)

PMID Year Title