Property Summary

NCBI Gene PubMed Count 35
PubMed Score 39.32
PubTator Score 21.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 1.4
Disease Target Count Z-score Confidence
Dentin caries 5 3.849 1.9
Scabies 7 3.525 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.400 1.3e-05
diabetes mellitus -1.100 3.2e-02
non-small cell lung cancer 1.180 5.7e-20
ovarian cancer 2.500 1.5e-06
pancreatic ductal adenocarcinoma liver m... -1.922 4.2e-02

Synonym

Accession Q9UBS4 Q542Y5 Q542Y9 Q6IAQ8 Q96JC6
Symbols DJ9
EDJ
Dj-9
ERj3
ABBP2
ERdj3
ERj3p
ABBP-2
UNQ537
PRO1080

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (11)

Gene RIF (20)

AA Sequence

MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDL      1 - 70
GAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEV     71 - 140
TLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV    141 - 210
EIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHL    211 - 280
DGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQK    281 - 350
VYNGLQGY                                                                  351 - 358
//

Text Mined References (40)

PMID Year Title