Property Summary

NCBI Gene PubMed Count 33
Grant Count 17
R01 Count 11
Funding $1,441,810.57
PubMed Score 35.70
PubTator Score 21.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.922 0.042
non-small cell lung cancer 1.180 0.000
diabetes mellitus -1.100 0.032
ovarian cancer 2.500 0.000
Breast cancer 1.400 0.000

Gene RIF (18)

PMID Text
26085089 BiP facilitates Sec61 channel closure (i.e. limits ER Ca(2+) leakage) via the Sec61 channel with the help of ERj3 and ERj6
25361606 regulated co-secretion of ERdj3 with misfolded clients directly links ER and extracellular proteostasis during conditions of ER stress.
25143379 ERdj3 mutant bound to unfolded endoplasmic reticulum proteins under steady state conditions in much greater amounts than wild-type.
25126989 Depleting ERdj3 reduced the rate of mutant GCase degradation in patient-derived fibroblasts, while increasing folding, trafficking, and function by directing GCase to the profolding ER calnexin pathway.
23378021 ERdjs appear to play the dual roles of increasing BiP affinity for clients and regulating delivery of clients to BiP.
22190034 HIV-1 gp120 is identified to have a physical interaction with DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 gp120 is identified to have a physical interaction with DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21844235 These data identify ERdj3 as a host protein involved with the cholera toxin intoxication process and provide new molecular details regarding cholera toxin A1-chaperone interactions.
21673190 In addition, BiP formed a complex with SV40 capsids in the endoplasmic reticulum in a DNAJB11-dependent fashion.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDL      1 - 70
GAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEV     71 - 140
TLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV    141 - 210
EIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHL    211 - 280
DGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQK    281 - 350
VYNGLQGY                                                                  351 - 358
//

Text Mined References (38)

PMID Year Title
26085089 2015 Co-chaperone Specificity in Gating of the Polypeptide Conducting Channel in the Membrane of the Human Endoplasmic Reticulum.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25361606 2015 Unfolded protein response-induced ERdj3 secretion links ER stress to extracellular proteostasis.
25143379 2014 Dissection of structural and functional requirements that underlie the interaction of ERdj3 protein with substrates in the endoplasmic reticulum.
25126989 2014 ERdj3 is an endoplasmic reticulum degradation factor for mutant glucocerebrosidase variants linked to Gaucher's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
23378021 2013 ERdj3 regulates BiP occupancy in living cells.
21844235 2011 Structural and functional interactions between the cholera toxin A1 subunit and ERdj3/HEDJ, a chaperone of the endoplasmic reticulum.
21673190 2011 BiP and multiple DNAJ molecular chaperones in the endoplasmic reticulum are required for efficient simian virus 40 infection.
More...