Property Summary

NCBI Gene PubMed Count 34
PubMed Score 117.22
PubTator Score 34.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.18927393074909E-18
periodontitis 269 4.15231866338053E-17
ovarian cancer 8492 3.52184107741019E-9
ulcerative colitis 2087 6.53792735566562E-8
psoriasis 6685 1.33999743727678E-7
tuberculosis 1563 1.34084901767943E-6
interstitial cystitis 2299 2.51846637949425E-5
lung cancer 4473 1.34825945956468E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 8.65785205265247E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0016377217029982
pancreatic cancer 2300 0.00205594486065634
dermatomyositis 967 0.00666185490654099
active Crohn's disease 918 0.00991883612956729
non primary Sjogren syndrome sicca 840 0.0139887091785205
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0224742347126096
Multiple myeloma 1328 0.0334302909358535
spina bifida 1064 0.0408825584554193
Disease Target Count Z-score Confidence
Familial encephalopathy with neuroserpin inclusion bodies 8 3.388 1.7

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.007 0.033
periodontitis 1.100 0.000
tuberculosis -1.200 0.000
pancreatic ductal adenocarcinoma liver m... -2.567 0.001
intraductal papillary-mucinous carcinoma... -1.600 0.002
intraductal papillary-mucinous neoplasm ... -1.700 0.022
lung cancer -1.600 0.000
active Crohn's disease 1.769 0.010
interstitial cystitis 1.700 0.000
non primary Sjogren syndrome sicca 1.200 0.014
psoriasis -1.200 0.000
lung carcinoma 1.600 0.000
spina bifida -1.212 0.041
ulcerative colitis 2.100 0.000
ovarian cancer -2.700 0.000
pancreatic cancer -1.300 0.002
dermatomyositis 1.100 0.007

Synonym

Accession Q9UBS3
Symbols MDG1
ERdj4
MDG-1
MST049
MSTP049

Gene

PDB

2CTR  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (2)

PMID Text
25146923 these results demonstrate that DNAJB9 is a downstream target of p53 that belongs to the group of negative feedback regulators of p53.
18400946 ERdj4 and ERdj5 promote turnover of misfolded SP-C and this activity is dependent on their ability to stimulate BiP ATPase activity.

AA Sequence

MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREI      1 - 70
AEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENH     71 - 140
FQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRR    141 - 210
GNMVTTYTDCSGQ                                                             211 - 223
//

Text Mined References (36)

PMID Year Title
25146923 2015 Genotoxic stress/p53-induced DNAJB9 inhibits the pro-apoptotic function of p53.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22006218 2012 Large-scale genome-wide association study of Asian population reveals genetic factors in FRMD4A and other loci influencing smoking initiation and nicotine dependence.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
20554776 2010 Coxsackievirus B3 infection activates the unfolded protein response and induces apoptosis through downregulation of p58IPK and activation of CHOP and SREBP1.
20335527 2010 HLA-B35 upregulates endothelin-1 and downregulates endothelial nitric oxide synthase via endoplasmic reticulum stress response in endothelial cells.
20054003 2010 Inhibition of secretion of interleukin (IL)-12/IL-23 family cytokines by 4-trifluoromethyl-celecoxib is coupled to degradation via the endoplasmic reticulum stress protein HERP.
19815549 2009 Meckel-Gruber syndrome protein MKS3 is required for endoplasmic reticulum-associated degradation of surfactant protein C.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
More...