Property Summary

NCBI Gene PubMed Count 35
PubMed Score 122.14
PubTator Score 34.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.201 1.3e-02
dermatomyositis 1.100 6.7e-03
interstitial cystitis 1.200 6.8e-03
intraductal papillary-mucinous carcinoma... -1.500 1.3e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.7e-02
lung cancer -1.300 8.4e-05
lung carcinoma 1.600 1.2e-18
Multiple myeloma 1.007 3.3e-02
non primary Sjogren syndrome sicca 1.200 1.4e-02
ovarian cancer -2.100 7.2e-10
pancreatic cancer -1.300 2.1e-03
pancreatic ductal adenocarcinoma liver m... -2.567 8.7e-04
periodontitis 1.100 4.2e-17
psoriasis -1.200 1.3e-07
spina bifida -1.212 4.1e-02
tuberculosis -1.200 1.3e-06
ulcerative colitis 1.600 1.0e-05

Synonym

Accession Q9UBS3
Symbols MDG1
ERdj4
MDG-1
MST049
MSTP049

Gene

PDB

2CTR  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (3)

AA Sequence

MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREI      1 - 70
AEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENH     71 - 140
FQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRR    141 - 210
GNMVTTYTDCSGQ                                                             211 - 223
//

Text Mined References (37)

PMID Year Title