Property Summary

NCBI Gene PubMed Count 21
PubMed Score 52.34
PubTator Score 179.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Ovarian cystadenoma 5 3.323 1.7
Varicocele 26 3.242 1.6

Expression

Synonym

Accession Q9UBR5 C9JE38 Q9UHM7 Q9UHN8 Q9UI41
Symbols C32
CKLF1
CKLF2
CKLF3
CKLF4
UCK-1
HSPC224

Gene

  Ortholog (1)

Species Source Disease
Macaque EggNOG Inparanoid

Gene RIF (14)

AA Sequence

MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFILLYVLRLDRL      1 - 70
MKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVCCLADGALIYRKLLFNPSGPY     71 - 140
QKKPVHEKKEVL                                                              141 - 152
//

Text Mined References (23)

PMID Year Title