Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
Funding $33,168
PubMed Score 49.10
PubTator Score 179.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Ovarian cystadenoma 5 3.396 1.7

Expression

Gene RIF (12)

PMID Text
26986142 expression elevated in the skin of keloid patients
25915746 role in the pathogenesis of psoriasis by promoting the proliferation of microvascular endothelial cells
23983609 Chemokine-like factor 1 is over-expressed in patients with atopic dermatitis.
23253812 CKLF1 can induce proliferation and inhibit apoptosis of human vascular smooth muscle cell through the down-regulation of Bax and Caspase-3 and the up-regulation of Bcl-2 expression.
20392439 CKLF1-C19 and -C27 can stimulate antigen-presenting capability of dendritic cells
20237496 Observational study of gene-disease association. (HuGE Navigator)
20137403 The expression of CKLF1 is up-regulated in atherosclerotic plaques.
19460752 Knockdown of chemokine-like factor (CKLF; HSPC224) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18976975 Knockdown of chemokine-like factor (CKLF; HSPC224) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18294340 Chemokine-like factor expression is differentially regulated in myoblasts and myotubes and thrombin could be a strong regulator for its expression
More...

AA Sequence

MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFILLYVLRLDRL      1 - 70
MKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVCCLADGALIYRKLLFNPSGPY     71 - 140
QKKPVHEKKEVL                                                              141 - 152
//

Text Mined References (21)

PMID Year Title
26986142 2016 Chemokine-Like Factor 1 (CKLF-1) is Overexpressed in Keloid Patients: A Potential Indicating Factor for Keloid-Predisposed Individuals.
25915746 2015 Chemokine-like factor 1-derived C-terminal peptides induce the proliferation of dermal microvascular endothelial cells in psoriasis.
23983609 2013 Chemokine-like factor 1 (CLFK1) is over-expressed in patients with atopic dermatitis.
23253812 2012 [Effects of chemokine-like factor 1 on the proliferation and apoptosis of human vascular smooth muscle cell].
20392439 2010 Expressional and functional studies of CKLF1 during dendritic cell maturation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20137403 2009 [The expression of chemokine-like factor 1 in human atherosclerotic plaques].
19946888 2010 Defining the membrane proteome of NK cells.
18294340 2008 Chemokine-like factor expression in the idiopathic inflammatory myopathies.
18069042 2008 Two C-terminal peptides of human CKLF1 interact with the chemokine receptor CCR4.
More...