Property Summary

NCBI Gene PubMed Count 38
PubMed Score 96.20
PubTator Score 58.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Winkelman Bethge Pfeiffer syndrome 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 4.6e-11
psoriasis 6694 2.2e-05
pituitary cancer 1972 6.4e-04
medulloblastoma, large-cell 6241 2.2e-03
Disease Target Count Z-score Confidence
Panhypopituitarism 14 0.0 5.0

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 2.100 2.2e-03
ovarian cancer 1.800 4.6e-11
pituitary cancer -2.400 6.4e-04
psoriasis -1.400 2.2e-05

Gene RIF (25)

AA Sequence

MLLETGLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCF      1 - 70
SRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLV     71 - 140
CKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRA    141 - 210
KEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPT    211 - 280
QALGRPSGALGNFSLEHGGLAGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSG    281 - 350
APGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF                           351 - 397
//

Text Mined References (41)

PMID Year Title