Property Summary

NCBI Gene PubMed Count 39
Grant Count 6
R01 Count 5
Funding $594,894.68
PubMed Score 68.02
PubTator Score 56.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 3.100 0.000
interstitial lung disease -1.200 0.042
Multiple myeloma 1.174 0.008
malignant mesothelioma -1.700 0.000
oligodendroglioma -1.200 0.019
permanent atrial fibrillation -1.300 0.037
esophageal adenocarcinoma 1.500 0.028
osteosarcoma -2.568 0.000
glioblastoma 1.300 0.029
atypical teratoid / rhabdoid tumor -1.900 0.016
medulloblastoma, large-cell -3.100 0.000
tuberculosis 1.200 0.000
diabetes mellitus -1.300 0.012
interstitial cystitis 1.400 0.003
subependymal giant cell astrocytoma 1.729 0.015
invasive ductal carcinoma 1.907 0.000
lung carcinoma -1.700 0.000
gastric carcinoma 1.400 0.020
ovarian cancer 1.500 0.000

Gene RIF (20)

PMID Text
25442015 Cathepsin X (CTSX) is involved in early tumorigenesis and in the stabilization of tumor cell formation in colorectal cancer.
25433997 Down-regulation of RPLP0 resulted in G1 arrest of gastric cancer cells, whereas knockdown of Cathepsin X led to G1 arrest and apoptosis
24725597 The significant association of cathepsin X with survival in a group of patients who received no chemotherapy and the absence of this association in the group who received chemotherapy, suggest the possible predictive value for response to chemotherapy.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of cathepsin Z (CTSZ) expression by HIV-1 Vpr in Vpr transduced macrophages
23827504 Suggest CTSZ rs34069356 polymorphism is not associated with pulmonary tuberculosis in a sample Iranian population.
22632162 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of cathepsin Z (CTSZ) expression by HIV-1 Vpr in Vpr transduced macrophages
22451661 Cathepsins L and Z are critical in degrading polyglutamine-containing proteins within lysosomes.
21966391 cathepsin Z contributes to tumor metastasis by inducing epithelial-mesenchymal transition in hepatocellular carcinoma
21616554 cathepsin X deficiency leads to accelerated cellular senescence and consequently to diminished cellular proliferation and migration/invasion implying a potential role of cathepsin X in bypassing cellular senescence.
21454358 We show that sequential cleavage of C-terminal amino acids from the beta(2) cytoplasmic tail of LFA-1, by CatX, enhances binding of the adaptor protein talin to LFA-1 and triggers formation of the latter's high-affinity form
More...

AA Sequence

MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRN      1 - 70
VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSV     71 - 140
WDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANG    141 - 210
PISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY    211 - 280
KDGKGARYNLAIEEHCTFGDPIV                                                   281 - 303
//

Text Mined References (45)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25442015 2014 Characterization of cathepsin X in colorectal cancer development and progression.
25433997 2015 Dysregulation of apoptotic signaling pathways by interaction of RPLP0 and cathepsin X/Z in gastric cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24725597 2014 Prognostic and predictive value of cathepsin X in serum from colorectal cancer patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23827504 2013 Association of CTSZ rs34069356 and MC3R rs6127698 gene polymorphisms with pulmonary tuberculosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...