Property Summary

NCBI Gene PubMed Count 20
PubMed Score 45.67
PubTator Score 27.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.7e-02
nephrosclerosis -1.875 1.0e-02
osteosarcoma -2.230 1.3e-06
ovarian cancer -1.200 3.0e-05
psoriasis -2.700 1.9e-44
tuberculosis -2.100 5.1e-09

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFEAAEEQLRRPR      1 - 70
IVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEAWTMPFAFCTREKLPWTEFAE     71 - 140
SAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNTAVVISNSGAVLGKTRKNHIPRVGDFNESTY    141 - 210
YMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATIGALSESLWPIEARNAAIANH    211 - 280
CFTCAINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDGLLVAKLDLNLCQQV    281 - 350
NDVWNFKMTGRYEMYARELAEAVKSNYSPTIVKE                                        351 - 384
//

Text Mined References (22)

PMID Year Title