Property Summary

NCBI Gene PubMed Count 25
PubMed Score 81.80
PubTator Score 74.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
lung cancer 1.100 1.9e-02
Multiple myeloma 1.280 1.9e-03
non primary Sjogren syndrome sicca 1.200 3.0e-02
osteosarcoma -1.318 4.6e-04
ovarian cancer 1.700 4.5e-05
pancreatic ductal adenocarcinoma liver m... -2.081 5.5e-04
psoriasis -1.300 1.6e-04

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDA      1 - 70
AGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTS     71 - 140
WKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSD    141 - 210
FIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH    211 - 280
PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL                          281 - 328
//

Text Mined References (28)

PMID Year Title