Property Summary

NCBI Gene PubMed Count 25
Grant Count 52
R01 Count 32
Funding $8,706,125.87
PubMed Score 90.43
PubTator Score 74.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.280 0.002
psoriasis -1.300 0.000
osteosarcoma -1.318 0.000
pancreatic ductal adenocarcinoma liver m... -2.081 0.001
lung cancer 1.100 0.019
non primary Sjogren syndrome sicca 1.200 0.030
ovarian cancer 1.900 0.000

Gene RIF (7)

PMID Text
24116921 GRHPR was genotyped in Japanese patients with PH2 and all GRHPR mutations described to date were reviewed in terms of geographic and ethnic association
23599041 GRHPR directly interacts with SVCT1.
23486161 Our findings suggest that the GRHPR defect in noncancerous tissues may represent an independent predictor of poor survival for hepatocellular carcinoma patients after curative resection
19296982 Observational study of gene-disease association. (HuGE Navigator)
17510093 the GRHPR gene may have a role in primary hyperoxaluria type 2 in a Japanese patient [case report]
16756993 substrate specificity of human glyoxylate reductase
15327387 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDA      1 - 70
AGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTS     71 - 140
WKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSD    141 - 210
FIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH    211 - 280
PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL                          281 - 328
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116921 2014 Ethnic differences in GRHPR mutations in patients with primary hyperoxaluria type 2.
23599041 2013 Glyoxalate reductase/hydroxypyruvate reductase interacts with the sodium-dependent vitamin C transporter-1 to regulate cellular vitamin C homeostasis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23486161 2013 Glyoxylate reductase/hydroxypyruvate reductase: a novel prognostic marker for hepatocellular carcinoma patients after curative resection.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19296982 2009 Late diagnosis of primary hyperoxaluria type 2 in the adult: effect of a novel mutation in GRHPR gene on enzymatic activity and molecular modeling.
More...