Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.78
PubTator Score 10.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
malignant mesothelioma 3232 2.5e-07
ovarian cancer 8519 2.7e-05
Pick disease 1894 8.7e-05
osteosarcoma 7950 3.9e-04
lung cancer 4740 5.1e-04
Alzheimer's disease 658 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0
Disease Target Count Z-score Confidence
Exostosis 15 6.059 3.0

Expression

  Differential Expression (6)

Disease log2 FC p
Alzheimer's disease -1.100 2.6e-02
lung cancer 2.300 5.1e-04
malignant mesothelioma -1.500 2.5e-07
osteosarcoma 1.875 3.9e-04
ovarian cancer -1.300 2.7e-05
Pick disease -1.700 8.7e-05

 MGI Phenotype (1)

 CSPA Cell Line (1)

Gene RIF (3)

AA Sequence

MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKSTMDSFTLIM      1 - 70
QTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPE     71 - 140
LETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSM    141 - 210
VLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGY    211 - 280
SGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNIMISQFGFPYANYKRKI                        281 - 330
//

Text Mined References (14)

PMID Year Title