Property Summary

NCBI Gene PubMed Count 25
Grant Count 6
R01 Count 5
Funding $306,273.05
PubMed Score 37.83
PubTator Score 199.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.625 0.001
malignant mesothelioma 1.100 0.000
psoriasis -1.200 0.002
osteosarcoma -1.060 0.007
atypical teratoid / rhabdoid tumor -1.200 0.001
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.300 0.001
diabetes mellitus -1.100 0.005
pediatric high grade glioma -1.100 0.000
Pick disease 1.100 0.000
ovarian cancer 1.700 0.002

Synonym

Accession Q9UBQ5 A8K0I9 B7ZAM9 Q96IQ0 Q9Y6D1 eIF3k
Symbols M9
ARG134
PLAC24
PTD001
EIF3S12
HSPC029
MSTP001
PLAC-24
PRO1474
EIF3-p28

Gene

PDB

3J8B   3J8C   1RZ4  

Gene RIF (7)

PMID Text
24036361 eIF3K subunit interacts directly with the PML protein.
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit K (EIF3K) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit K (EIF3K) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18577580 eIF3k, originally identified as the smallest subunit of eukaryotic translation initiation factor 3 (eIF3) complexes, also localizes to keratin intermediate filaments and physically associates with K18 in epithelial cells.
15327989 cyclin D3 specifically interacted with eIF3k through its C-terminal domain; eIF3k distributed both in nucleus and cytoplasm and colocalized with cyclin D3
15180986 eIF3k has three putative protein-binding surfaces and has potential RNA binding activity
12006665 identification of a novel 24-kDa protein that binds directly to dynein intermediate chain [PLAC-24]

AA Sequence

MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQIL      1 - 70
LKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRK     71 - 140
FICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSV    141 - 210
SSIMASSQ                                                                  211 - 218
//

Text Mined References (39)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25416956 2014 A proteome-scale map of the human interactome network.
24036361 2013 The translation initiation factor 3 subunit eIF3K interacts with PML and associates with PML nuclear bodies.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22190034 2011 Global landscape of HIV-human protein complexes.
More...