Property Summary

NCBI Gene PubMed Count 28
PubMed Score 38.30
PubTator Score 199.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 5.2e-04
diabetes mellitus -1.100 4.7e-03
glioblastoma -1.300 6.8e-05
malignant mesothelioma 1.100 3.5e-05
medulloblastoma, large-cell -1.300 1.2e-03
Multiple myeloma 1.202 4.7e-03
osteosarcoma -1.008 8.5e-03
ovarian cancer -1.300 1.4e-03
pediatric high grade glioma -1.100 1.9e-04
Pick disease 1.100 3.3e-05
psoriasis -1.200 1.7e-03

Gene RIF (6)

AA Sequence

MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQIL      1 - 70
LKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRK     71 - 140
FICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSV    141 - 210
SSIMASSQ                                                                  211 - 218
//

Text Mined References (42)

PMID Year Title