Property Summary

NCBI Gene PubMed Count 37
PubMed Score 37.70
PubTator Score 19.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma 1.200 3.7e-02
hereditary spastic paraplegia -1.108 5.8e-03
ovarian cancer -1.600 7.7e-05
pancreatic cancer 1.200 2.6e-03
primary pancreatic ductal adenocarcinoma 1.119 9.4e-03

 GO Function (1)

Gene RIF (11)

AA Sequence

MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYP      1 - 70
EQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYN     71 - 140
ALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKP                                141 - 182
//

Text Mined References (44)

PMID Year Title