Property Summary

NCBI Gene PubMed Count 33
PubMed Score 33.83
PubTator Score 19.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 7.67864766071187E-5
pancreatic cancer 2300 0.00258599897577685
hereditary spastic paraplegia 313 0.00584468780318917
primary pancreatic ductal adenocarcinoma 1271 0.00938304836377371
breast carcinoma 1614 0.0367698321474156

Expression

  Differential Expression (5)

Disease log2 FC p
hereditary spastic paraplegia -1.108 0.006
primary pancreatic ductal adenocarcinoma 1.119 0.009
breast carcinoma 1.200 0.037
ovarian cancer -1.600 0.000
pancreatic cancer 1.200 0.003

Synonym

Accession Q9UBQ0 Q502Y5 Q6FIF8 Q6IAH3 Q9H0W0 Q9NRP1 Q9NRU7 hVPS29
Symbols DC7
DC15
PEP11

Gene

PDB

2R17   1W24  

  Ortholog (9)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

 GO Function (1)

Gene RIF (9)

PMID Text
25937119 Data indicate that vesicular transport proteins VPS35 and VPS29 influence the levels of the other subunit of retromer.
25475142 This study demonstrated that Genetic variability of VPS29 in parkinsonism.
24684791 Mutations in the gene composing the retromer cargo recognition subunit are not a common cause of Parkinson's disease.
21629666 Conclusion is that VPS29 is a metal ion-independent, rigid scaffolding domain, which is essential but not sufficient for incorporation of retromer into functional endosomal transport assemblies.
19531583 Membrane recruitment of the cargo-selective retromer subcomplex VPS35/29/26 is catalysed by the small GTPase Rab7 and inhibited by the Rab-GAP TBC1D5.
17891154 crystal structure of a VPS29-VPS35 subcomplex showing how the metallophosphoesterase-fold subunit VPS29 acts as a scaffold for the carboxy-terminal half of VPS35
17101778 These observations indicate that the mammalian retromer complex assembles by sequential association of SNX1/2 and Vps26-Vps29-Vps35 subcomplexes on endosomal membranes and that SNX1 and SNX2 play interchangeable but essential roles.
16737443 It was demonstrated that recombinant human Vps29 displays in vitro phosphatase activity towards a serine-phosphorylated peptide, containing the acidic-cluster dileucine motif of the cytoplasmatic tail of the CI-M6PR.
15788412 analysis of the phosphodiesterase/nuclease-like fold and two protein-protein interaction sites in human VPS29

AA Sequence

MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYP      1 - 70
EQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYN     71 - 140
ALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKP                                141 - 182
//

Text Mined References (40)

PMID Year Title
27385586 2016 Parkinson Disease-linked Vps35 R524W Mutation Impairs the Endosomal Association of Retromer and Induces ?-Synuclein Aggregation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25937119 2015 VPS29-VPS35 intermediate of retromer is stable and may be involved in the retromer complex assembly process.
25475142 2015 Genetic variability of the retromer cargo recognition complex in parkinsonism.
25416956 2014 A proteome-scale map of the human interactome network.
24856514 2014 VARP is recruited on to endosomes by direct interaction with retromer, where together they function in export to the cell surface.
24684791 2014 Genetic variation of the retromer subunits VPS26A/B-VPS29 in Parkinson's disease.
24603492 2014 TBC1D5 and the AP2 complex regulate ATG9 trafficking and initiation of autophagy.
More...