Property Summary

NCBI Gene PubMed Count 18
Grant Count 19
R01 Count 13
Funding $1,109,745.01
PubMed Score 65.39
PubTator Score 39.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
astrocytic glioma -1.400 0.041
oligodendroglioma -2.700 0.011
cutaneous lupus erythematosus -1.100 0.007
glioblastoma -1.600 0.027
osteosarcoma 4.469 0.000
posterior fossa group B ependymoma -1.900 0.000
cystic fibrosis -1.659 0.000
atypical teratoid / rhabdoid tumor 1.100 0.036
medulloblastoma, large-cell -2.400 0.046
lung cancer -2.300 0.001
group 4 medulloblastoma -2.200 0.003
pilocytic astrocytoma -2.700 0.000
invasive ductal carcinoma -2.100 0.000
nasopharyngeal carcinoma -2.300 0.000
lung carcinoma -2.500 0.000
breast carcinoma -1.700 0.000
spina bifida -2.792 0.040
Breast cancer -2.100 0.000
ductal carcinoma in situ -1.600 0.003
ulcerative colitis -1.700 0.016
ovarian cancer -2.300 0.005
Gaucher disease type 3 -1.600 0.008
pituitary cancer -1.200 0.048

Gene RIF (13)

PMID Text
23167255 GULP1 only mediates LRP1 transactivation
22451657 GULP expression positively regulates TGF-beta signaling leading to growth inhibition, this may represent an attractive target to achieve TGF-beta responsiveness in ovarian cells.
22398720 The apoptotic engulfment protein Ced-6 participates in clathrin-mediated yolk uptake in Drosophila egg chambers.
21486224 overexpression of GULP1 enhanced the generation of APP CTFs (C-terminal fragments) and Abeta, whereas knockdown of GULP1 suppressed APP CTFs and Abeta production.
20674096 This study identify GULP1 as a novel neuronal amyloid-beta precursor protein interacting protein that alters trafficking and processing of amyloid-beta precursor protein.
20599701 these results indicate that GULP functions as an adaptor protein for stabilin-1-mediated phagocytosis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19721717 the GULP1 gene and the apoptotic engulfment pathway are involved in schizophrenia in subjects of European ancestry
19721717 Observational study of gene-disease association. (HuGE Navigator)
19122200 Phosphatidylserine-recognizing SR-BI activates associated GULP; activated GULP induces MAPK phosphorylation; activated MAPK increases GTP-bound Rac1; and activated Rac1 induces a rearrangement of the actin cytoskeleton.
More...

AA Sequence

MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKV      1 - 70
ELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLT     71 - 140
IGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSAPPAGSMTPK    141 - 210
SPSTDIFDMIPFSPISHQSSMPTRNGTQPPPVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEM    211 - 280
QEGFKMGLTLEGTVFCLDPLDSRC                                                  281 - 304
//

Text Mined References (29)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23167255 2013 Engulfment adaptor phosphotyrosine-binding-domain-containing 1 (GULP1) is a nucleocytoplasmic shuttling protein and is transactivationally active together with low-density lipoprotein receptor-related protein 1 (LRP1).
22451657 2012 Engulfment protein GULP is regulator of transforming growth factor-? response in ovarian cells.
22398720 2012 The apoptotic engulfment protein Ced-6 participates in clathrin-mediated yolk uptake in Drosophila egg chambers.
21486224 2011 GULP1 is a novel APP-interacting protein that alters APP processing.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20674096 2012 Engulfment adapter PTB domain containing 1 interacts with and affects processing of the amyloid-? precursor protein.
20599701 2010 Adaptor protein GULP is involved in stabilin-1-mediated phagocytosis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...