Property Summary

NCBI Gene PubMed Count 19
PubMed Score 71.07
PubTator Score 39.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
astrocytic glioma -1.400 4.1e-02
Astrocytoma, Pilocytic -2.400 2.9e-05
atypical teratoid / rhabdoid tumor 1.100 3.6e-02
Breast cancer -2.000 9.8e-07
breast carcinoma -1.600 7.7e-27
cutaneous lupus erythematosus -1.100 7.0e-03
cystic fibrosis -1.641 1.1e-06
ductal carcinoma in situ -1.600 3.2e-03
ependymoma -1.300 6.9e-03
Gaucher disease type 3 -1.600 7.7e-03
glioblastoma -1.600 2.7e-02
group 4 medulloblastoma -2.000 8.0e-03
invasive ductal carcinoma -1.050 9.6e-04
lung cancer -1.200 4.4e-02
lung carcinoma -2.500 5.6e-23
malignant mesothelioma -1.100 1.6e-05
medulloblastoma, large-cell -2.400 4.6e-02
nasopharyngeal carcinoma -2.000 2.4e-04
oligodendroglioma -2.000 2.5e-02
osteosarcoma 4.469 1.4e-05
ovarian cancer -2.200 4.6e-05
pituitary cancer -1.200 4.8e-02
spina bifida -2.792 4.0e-02
ulcerative colitis -1.700 1.6e-02

Gene RIF (14)

AA Sequence

MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKV      1 - 70
ELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLT     71 - 140
IGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSAPPAGSMTPK    141 - 210
SPSTDIFDMIPFSPISHQSSMPTRNGTQPPPVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEM    211 - 280
QEGFKMGLTLEGTVFCLDPLDSRC                                                  281 - 304
//

Text Mined References (30)

PMID Year Title