Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.67
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Dyslexia 43 3.989 2.0

AA Sequence

MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPP      1 - 70
ETNEKLTNPQVKEK                                                             71 - 84
//

Text Mined References (4)

PMID Year Title