Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.67
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Dyslexia 36 3.982 2.0

Synonym

Accession Q9UBP8
Symbols RU2AS

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPP      1 - 70
ETNEKLTNPQVKEK                                                             71 - 84
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10601354 1999 A new antigen recognized by cytolytic T lymphocytes on a human kidney tumor results from reverse strand transcription.