Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.03
PubTator Score 2.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2716 1.5e-07
psoriasis 6694 1.7e-03
lung cancer 4740 6.9e-03
adult high grade glioma 3801 1.1e-02
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0
Disease Target Count Z-score Confidence
Isolated growth hormone deficiency 30 3.136 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.500 1.1e-02
lung adenocarcinoma 1.300 1.5e-07
lung cancer 1.200 6.9e-03
psoriasis 1.400 1.7e-03

Gene RIF (6)

AA Sequence

MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKK      1 - 70
EKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSN     71 - 140
AMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTH    141 - 210
FEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH        211 - 276
//

Text Mined References (24)

PMID Year Title