Property Summary

NCBI Gene PubMed Count 42
Grant Count 151
R01 Count 82
Funding $15,069,887.71
PubMed Score 240.91
PubTator Score 161.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.200 0.000
posterior fossa group B ependymoma 2.400 0.000
glioblastoma 1.400 0.003
intraductal papillary-mucinous carcinoma... -1.200 0.002
interstitial cystitis 1.200 0.002
adult high grade glioma 1.200 0.004
pilocytic astrocytoma 2.800 0.000
Breast cancer -3.200 0.000
lung carcinoma 1.100 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q9UBP5
Symbols GRL
CHF1
HRT2
HERP1
HESR2
bHLHb32
GRIDLOCK

Gene

Gene RIF (20)

PMID Text
26729854 HEY2 CC genotype may be a favorable prognostic marker for BrS, protectively acting to prevent ventricular fibrillation presumably by regulating the repolarization current.
25832314 Individuals with HEY2 duplications should be screened for congenital heart defects.
25799559 bone morphogenic proteins within the serum of cell culture medium are potent inducers of endothelial Hey1 and Hey2 gene expression within the first few hours after medium change
25361534 Overexpression of HEY1 and HEY2 in esophageal squamous cell carcinoma (ESCC) is correlated to different indices of poor prognosis, and it is extrapolated that such overexpression is important in progression and development of ESCC tumorigenesis.
24366871 a new HRD1-associated membrane protein named HERP2, which is homologous to the previously identified HRD1 partner HERP1. Despite sequence homology, HERP2 is constitutively expressed in cells, whereas HERP1 is highly induced by ER stress.
24108462 Data indicate that culture abrogated differential gene expression in part due to gradual loss of canonical Notch activity and HEY2 expression.
23872634 Common variants at SCN5A-SCN10A and HEY2 are associated with Brugada syndrome, a rare disease with high risk of sudden cardiac death
23744056 Hey2 and COUP-TFII have an important role in arteriovenous differentiation of human endothelial cells.
22310065 Report down-regulation of Notch signaling components NOTCH3 and HEY2 in abdominal aortic aneurysms.
21362320 Through activating the Dll4-Notch-Hey2 signaling pathway, HGF indirectly promotes the proliferation and migration ability of cells, so that offspring artery branches are formed.
More...

AA Sequence

MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSE      1 - 70
LRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSV     71 - 140
EGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPNGLHASESTPC    141 - 210
RLSTTSEVPPAHGSALLTATFAHADSALRMPSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPL    211 - 280
SFAGAFPMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF                 281 - 337
//

Text Mined References (42)

PMID Year Title
26729854 2016 Common Variant Near HEY2 Has a Protective Effect on Ventricular Fibrillation Occurrence in Brugada Syndrome by Regulating the Repolarization Current.
25832314 2015 Duplication of HEY2 in cardiac and neurologic development.
25799559 2015 Serum induces transcription of Hey1 and Hey2 genes by Alk1 but not Notch signaling in endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
25361534 2015 Notch Signaling Target Genes are Directly Correlated to Esophageal Squamous Cell Carcinoma Tumorigenesis.
24366871 2014 Role of HERP and a HERP-related protein in HRD1-dependent protein degradation at the endoplasmic reticulum.
24108462 2013 Unraveling a novel transcription factor code determining the human arterial-specific endothelial cell signature.
23872634 2013 Common variants at SCN5A-SCN10A and HEY2 are associated with Brugada syndrome, a rare disease with high risk of sudden cardiac death.
23744056 2013 Impact of Hey2 and COUP-TFII on genes involved in arteriovenous differentiation in primary human arterial and venous endothelial cells.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
More...