Property Summary

NCBI Gene PubMed Count 43
PubMed Score 261.22
PubTator Score 161.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.200 5.5e-10
adult high grade glioma 1.100 1.3e-02
Astrocytoma, Pilocytic 2.800 3.1e-10
Breast cancer -3.200 7.0e-24
ependymoma 1.900 2.2e-06
glioblastoma 1.300 7.4e-04
interstitial cystitis 1.200 2.1e-03
intraductal papillary-mucinous carcinoma... -1.200 2.0e-03
lung carcinoma 1.100 1.2e-06
ovarian cancer 1.300 4.6e-03

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (21)

AA Sequence

MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSE      1 - 70
LRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSV     71 - 140
EGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPNGLHASESTPC    141 - 210
RLSTTSEVPPAHGSALLTATFAHADSALRMPSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPL    211 - 280
SFAGAFPMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF                 281 - 337
//

Text Mined References (43)

PMID Year Title