Property Summary

NCBI Gene PubMed Count 106
Grant Count 40
R01 Count 20
Funding $3,328,865.56
PubMed Score 149.93
PubTator Score 463.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (85)

PMID Text
27010856 these data suggest that downregulation of tubular beta-catenin signaling induced by Dkk-3 has a detrimental role in chronic proteinuria, partially through the increase in apoptosis.
26689513 first report documenting that DKK3 polymorphisms are not only associated with prostate cancer but also related to prostate cancer-related factors.
26503968 Observations highlight a role for Dkk-3 in modulating TGF-beta/MMP signals in the prostate and prostate cancer.
26397159 Down-regulation of Dkk3 is associated with recurrence in Endometrioid Adenocarcinoma.
26278164 beta2M-mediated VEGFR-2/Akt/mTOR phosphorylation and tumor angiogenesis was significantly suppressed by over-expression of DKK-3.
26119087 we propose that Dickkopf-related protein-3 (Dkk-3) might be a novel Amyloid-beta (Abeta) associated protein
26093488 Suggest that DKK3 may be important in mediating invasion in esophageal adenocarcinoma.
25823913 REIC/Dkk-3 is a naturally circulating serum protein, the upregulation REIC/Dkk-3 protein expression could be a promising option for cancer therapy
25760729 Epigenetic downregulation of DKK3 leads to docetaxel resistance in human nonsmall cell lung cancer (NSCLC) cells.
25604390 Loss of DKK3 protein expression was significantly associated with poor survival in patients with gastric cancer and was strongly correlated with the TNM stage.
More...

AA Sequence

MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVE      1 - 70
EMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEE     71 - 140
GRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDN    141 - 210
QRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSL    211 - 280
VYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAAAAALLGGEEI    281 - 350
//

Text Mined References (110)

PMID Year Title
27010856 2016 Downregulation of renal tubular Wnt/?-catenin signaling by Dickkopf-3 induces tubular cell death in proteinuric nephropathy.
26689513 Single nucleotide polymorphisms in DKK3 gene are associated with prostate cancer risk and progression.
26503968 2016 Dickkopf-3 regulates prostate epithelial cell acinar morphogenesis and prostate cancer cell invasion by limiting TGF-?-dependent activation of matrix metalloproteases.
26397159 2016 Expression Patterns of the Wnt Pathway Inhibitors Dickkopf3 and Secreted Frizzled-Related Proteins 1 and 4 in Endometrial Endometrioid Adenocarcinoma: An NRG Oncology/Gynecologic Oncology Group Study.
26278164 2015 Dickkopf-3 (DKK-3) obstructs VEGFR-2/Akt/mTOR signaling cascade by interacting of ?2-microglobulin (?2M) in ovarian tumorigenesis.
26119087 2015 Dickkopf-related protein 3 is a potential A?-associated protein in Alzheimer's Disease.
26093488 2015 The role of Dickkopf-3 overexpression in esophageal adenocarcinoma.
25823913 2015 The cysteine-rich core domain of REIC/Dkk-3 is critical for its effect on monocyte differentiation and tumor regression.
25760729 2015 DNA methylation of DKK3 modulates docetaxel chemoresistance in human nonsmall cell lung cancer cell.
25604390 2015 Aberrant loss of dickkopf-3 in gastric cancer: can it predict lymph node metastasis preoperatively?
More...