Property Summary

NCBI Gene PubMed Count 120
PubMed Score 168.44
PubTator Score 463.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (31)

Disease log2 FC p
adrenocortical carcinoma -2.352 2.3e-04
astrocytic glioma -2.200 8.6e-03
atypical teratoid / rhabdoid tumor -2.600 1.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.052 8.2e-03
Breast cancer 1.200 2.4e-02
breast carcinoma -1.100 6.7e-13
cystic fibrosis 1.200 5.3e-04
dermatomyositis 1.600 9.3e-03
Duchenne muscular dystrophy 1.270 4.4e-08
glioblastoma -1.200 2.1e-02
group 3 medulloblastoma -2.200 2.9e-05
intraductal papillary-mucinous adenoma (... -1.500 2.1e-02
intraductal papillary-mucinous carcinoma... -1.400 4.2e-02
intraductal papillary-mucinous neoplasm ... -2.200 3.9e-02
invasive ductal carcinoma 1.189 3.3e-03
juvenile dermatomyositis 1.206 5.0e-07
lung adenocarcinoma -1.700 4.7e-08
lung cancer -1.500 3.0e-03
medulloblastoma, large-cell -4.500 1.7e-06
nasopharyngeal carcinoma 1.200 8.8e-03
nephrosclerosis 1.242 4.2e-03
oligodendroglioma -1.600 5.3e-10
osteosarcoma 2.569 4.2e-04
ovarian cancer -2.600 1.1e-04
pancreatic cancer 1.100 4.1e-03
pituitary cancer -1.100 1.6e-02
primary pancreatic ductal adenocarcinoma 1.417 1.2e-02
psoriasis -1.800 2.6e-04
tuberculosis -1.900 6.3e-05
ulcerative colitis 2.000 8.3e-04
urothelial carcinoma 1.800 1.5e-02

 CSPA Cell Line (3)

Gene RIF (99)

AA Sequence

MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVE      1 - 70
EMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEE     71 - 140
GRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDN    141 - 210
QRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSL    211 - 280
VYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAAAAALLGGEEI    281 - 350
//

Text Mined References (124)

PMID Year Title