Property Summary

NCBI Gene PubMed Count 106
PubMed Score 149.93
PubTator Score 463.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 1.04914930120255E-21
Breast cancer 3099 9.78099985001619E-15
lung adenocarcinoma 2714 3.12309384655306E-11
oligodendroglioma 2849 5.26509232742986E-10
Duchenne muscular dystrophy 602 4.42167335915433E-8
atypical teratoid / rhabdoid tumor 4369 2.17698038842192E-7
group 4 medulloblastoma 1875 4.82946623370369E-7
juvenile dermatomyositis 1189 5.04987446545695E-7
medulloblastoma, large-cell 6234 1.72268598416586E-6
lung cancer 4473 4.95967857107837E-6
tuberculosis 1563 1.09102160383431E-5
urothelial carcinoma 318 1.44719132706881E-5
pancreatic cancer 2300 8.75661338005826E-5
ovarian cancer 8492 1.07531128864771E-4
primary pancreatic ductal adenocarcinoma 1271 1.32405853062366E-4
psoriasis 6685 2.61223047996151E-4
adrenocortical carcinoma 1427 3.38187118229027E-4
osteosarcoma 7933 4.22433539483206E-4
cystic fibrosis 1670 5.29115614718458E-4
ulcerative colitis 2087 8.26609526532524E-4
nephrosclerosis 329 0.00291774635818255
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0030265567373807
invasive ductal carcinoma 2950 0.00326676662653206
pituitary cancer 1972 0.00472203373135854
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00832995513759826
nasopharyngeal carcinoma 1056 0.00878209003116939
dermatomyositis 967 0.00929370607932753
astrocytic glioma 2241 0.010574755926076
glioblastoma 5572 0.0210530296204165
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0332516919813195
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0393599864719749
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.489 2.2

Expression

Synonym

Accession Q9UBP4 A8K1I2 D3DQW1 Q9ULB7 Dickkopf-3
Symbols RIG
REIC

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 CSPA Cell Line (3)

Gene RIF (85)

PMID Text
27010856 these data suggest that downregulation of tubular beta-catenin signaling induced by Dkk-3 has a detrimental role in chronic proteinuria, partially through the increase in apoptosis.
26689513 first report documenting that DKK3 polymorphisms are not only associated with prostate cancer but also related to prostate cancer-related factors.
26503968 Observations highlight a role for Dkk-3 in modulating TGF-beta/MMP signals in the prostate and prostate cancer.
26397159 Down-regulation of Dkk3 is associated with recurrence in Endometrioid Adenocarcinoma.
26278164 beta2M-mediated VEGFR-2/Akt/mTOR phosphorylation and tumor angiogenesis was significantly suppressed by over-expression of DKK-3.
26119087 we propose that Dickkopf-related protein-3 (Dkk-3) might be a novel Amyloid-beta (Abeta) associated protein
26093488 Suggest that DKK3 may be important in mediating invasion in esophageal adenocarcinoma.
25823913 REIC/Dkk-3 is a naturally circulating serum protein, the upregulation REIC/Dkk-3 protein expression could be a promising option for cancer therapy
25760729 Epigenetic downregulation of DKK3 leads to docetaxel resistance in human nonsmall cell lung cancer (NSCLC) cells.
25604390 Loss of DKK3 protein expression was significantly associated with poor survival in patients with gastric cancer and was strongly correlated with the TNM stage.
More...

AA Sequence

MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVE      1 - 70
EMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEE     71 - 140
GRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDN    141 - 210
QRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSL    211 - 280
VYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAAAAALLGGEEI    281 - 350
//

Text Mined References (110)

PMID Year Title
27010856 2016 Downregulation of renal tubular Wnt/?-catenin signaling by Dickkopf-3 induces tubular cell death in proteinuric nephropathy.
26689513 Single nucleotide polymorphisms in DKK3 gene are associated with prostate cancer risk and progression.
26503968 2016 Dickkopf-3 regulates prostate epithelial cell acinar morphogenesis and prostate cancer cell invasion by limiting TGF-?-dependent activation of matrix metalloproteases.
26397159 2016 Expression Patterns of the Wnt Pathway Inhibitors Dickkopf3 and Secreted Frizzled-Related Proteins 1 and 4 in Endometrial Endometrioid Adenocarcinoma: An NRG Oncology/Gynecologic Oncology Group Study.
26278164 2015 Dickkopf-3 (DKK-3) obstructs VEGFR-2/Akt/mTOR signaling cascade by interacting of ?2-microglobulin (?2M) in ovarian tumorigenesis.
26119087 2015 Dickkopf-related protein 3 is a potential A?-associated protein in Alzheimer's Disease.
26093488 2015 The role of Dickkopf-3 overexpression in esophageal adenocarcinoma.
25823913 2015 The cysteine-rich core domain of REIC/Dkk-3 is critical for its effect on monocyte differentiation and tumor regression.
25760729 2015 DNA methylation of DKK3 modulates docetaxel chemoresistance in human nonsmall cell lung cancer cell.
25604390 2015 Aberrant loss of dickkopf-3 in gastric cancer: can it predict lymph node metastasis preoperatively?
More...