Property Summary

NCBI Gene PubMed Count 162
PubMed Score 260.27
PubTator Score 333.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hereditary spastic paraplegia 4 7 0.0 5.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 3.04 1.5
hereditary spastic paraplegia 318 0.0 4.0
Disease Target Count Z-score Confidence
Chromosome 1q21.1 duplication syndrome 2 4.293 2.1

Expression

  Differential Expression (7)

Disease log2 FC p
aldosterone-producing adenoma -1.036 1.6e-02
Gaucher disease type 1 -1.100 5.7e-03
group 3 medulloblastoma 1.200 1.1e-02
lung cancer 1.700 4.9e-03
non-small cell lung cancer 1.389 4.3e-11
primary Sjogren syndrome 1.200 4.3e-04
primitive neuroectodermal tumor 1.100 5.9e-04

Protein-protein Interaction (10)

Gene RIF (134)

AA Sequence

MNSPGGRGKKKGSGGASNPVPPRPPPPCLAPAPPAAGPAPPPESPHKRNLYYFSYPLFVGFALLRLVAFH      1 - 70
LGLLFVWLCQRFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAG     71 - 140
QKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLEKMQPVLPFSKSQTD    141 - 210
VYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQ    211 - 280
GSGPAPTTHKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLA    281 - 350
KQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGE    351 - 420
KLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQ    421 - 490
ELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGP    491 - 560
IRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV                  561 - 616
//

Text Mined References (178)

PMID Year Title