Property Summary

NCBI Gene PubMed Count 204
Grant Count 255
R01 Count 168
Funding $27,877,994.26
PubMed Score 464.16
PubTator Score 374.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
oligodendroglioma 1.100 0.016
osteosarcoma -1.285 0.001
astrocytoma 1.100 0.002
medulloblastoma 1.100 0.000
colon cancer 1.100 0.023
lung cancer 1.800 0.008

Synonym

Accession Q9UBN7 O94975 Q6NT75 Q7L3E5 Q96CY0 HD6
Symbols HD6
JM21
CPBHM
PPP1R90

Gene

PANTHER Protein Class (2)

PDB

3PHD   3C5K   3GV4   5B8D   5EDU   5KH3   5KH7   5KH9  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651906 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC6

Gene RIF (176)

PMID Text
26783207 Shp2 also mediates Cdc42 repression, and HDAC6 inhibition or co-suppression of ERK/myosin II promotes normal epithelial lumen phenotype without increasing Cdc42 activity.
26763233 TGF-beta increased activity of HDAC6 without affecting its expression levels.
26747087 HDAC5 and HDAC6 were highly expressed in melanoma cells but exhibited low expression levels in normal skin cells.
26746851 HDAC6 transiently bound to RIG-I and removed the lysine 909 acetylation in the presence of viral RNAs, promoting RIG-I sensing of viral RNAs.
26643555 HDAC6 is a functionally necessary gene to maintain inflammatory breast cancer cell viability.
26524593 HDAC6 in glioma cells appears to alter the trafficking of post-entry oncolytic viruses from the nucleus toward lysosomes. HDAC6's role in the antiviral effect is linked to the microtubule acetylation status.
26502922 Enhanced HDAC-6 expression in Pancreatic Adenocarcinoma was significantly associated with earlier stage and borderline with smaller tumor size. Enhanced HDAC-1 and -6 expression showed longer survival times compared to those with low expression.
26388610 The inhibitory effect of nuclear HDAC6 on invasion of NSCLC was mediated by the deacetylation of the p65 subunit of nuclear factor-kappaB, which decreased its DNA-binding activity to the MMP2 promoter, leading to the downregulation of MMP2 expression.
26382850 HDAC6 is necessary to modulate sodium-dependent tubulin acetylation.
26328501 S-nitrosylation of HDAC6 plays a pivotal role in the regulation of protein acetylation
More...

AA Sequence

MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVG      1 - 70
LQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEE     71 - 140
LMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAII    141 - 210
RPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQ    211 - 280
GRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQG    281 - 350
DPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA    351 - 420
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMM    421 - 490
NHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRELH    491 - 560
RESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAA    561 - 630
RHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFT    631 - 700
VNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLA    701 - 770
SGRIILILEGGYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE    771 - 840
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQP    841 - 910
SEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTT    911 - 980
SEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLI    981 - 1050
GSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVC   1051 - 1120
PIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYV   1121 - 1190
HHQALLDVKNIAHQNKFGEDMPHPH                                                1191 - 1215
//

Text Mined References (212)

PMID Year Title
26783207 2016 The Shp2-induced epithelial disorganization defect is reversed by HDAC6 inhibition independent of Cdc42.
26763233 2016 Loss of ?-Tubulin Acetylation Is Associated with TGF-?-induced Epithelial-Mesenchymal Transition.
26747087 2016 Both HDAC5 and HDAC6 are required for the proliferation and metastasis of melanoma cells.
26746851 2016 HDAC6 regulates cellular viral RNA sensing by deacetylation of RIG-I.
26643555 2015 HDAC6 activity is a non-oncogene addiction hub for inflammatory breast cancers.
26524593 2015 Histone deacetylase 6 inhibition enhances oncolytic viral replication in glioma.
26502922 2015 Histone deacetylase (HDAC)-1, -2, -4 and -6 expression in human pancreatic adenocarcinoma: associations with clinicopathological parameters, tumor proliferative capacity and patients' survival.
26388610 2015 Nuclear HDAC6 inhibits invasion by suppressing NF-?B/MMP2 and is inversely correlated with metastasis of non-small cell lung cancer.
26382850 2015 EGF-induced sodium influx regulates EGFR trafficking through HDAC6 and tubulin acetylation.
26328501 2015 Regulation of Histone Deacetylase 6 Activity via S-Nitrosylation.
More...