Property Summary

Ligand Count 1,367
NCBI Gene PubMed Count 230
PubMed Score 545.27
PubTator Score 374.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
medulloblastoma 720 4.0e-05
osteosarcoma 7950 1.2e-03
astrocytoma 1146 2.3e-03
lung cancer 4740 7.5e-03
oligodendroglioma 2850 1.6e-02
colon cancer 1478 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 4.735 2.4
Neurodegenerative disease 414 3.626 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 2.3e-03
colon cancer 1.100 2.3e-02
lung cancer 1.800 7.5e-03
medulloblastoma 1.100 4.0e-05
oligodendroglioma 1.100 1.6e-02
osteosarcoma -1.285 1.2e-03

Protein-protein Interaction (10)

Gene RIF (188)

AA Sequence

MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVG      1 - 70
LQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEE     71 - 140
LMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAII    141 - 210
RPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQ    211 - 280
GRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQG    281 - 350
DPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA    351 - 420
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMM    421 - 490
NHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRELH    491 - 560
RESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAA    561 - 630
RHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFT    631 - 700
VNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLA    701 - 770
SGRIILILEGGYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE    771 - 840
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQP    841 - 910
SEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTT    911 - 980
SEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLI    981 - 1050
GSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVC   1051 - 1120
PIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYV   1121 - 1190
HHQALLDVKNIAHQNKFGEDMPHPH                                                1191 - 1215
//

Text Mined References (238)

PMID Year Title