Property Summary

NCBI Gene PubMed Count 54
Grant Count 53
R01 Count 38
Funding $2,809,011.98
PubMed Score 38.68
PubTator Score 74.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (45)

PMID Text
26542757 Results identified epigenetic inactivation of TNFRSF10C and TNFRSF10D in majority of cervical cancer cases.
26050621 DcRs regulate TRAIL sensitivity at a supracellular level
25980612 Infectious wild type HIV-1 production is restricted by 293T cells over-expressing TNFRSF10D
25003639 This study identified TNFRSF10D DNA methylation status as an independent prognostic biomarker for relapse-free survival and overall mortality in non-metastatic melanoma patients.
24649804 membrane expression more common in endometrioid endometrial cancer than in normal endometrium
24211571 the results presented here claim for a relevant impact of aberrant methylation of decoy receptors in melanoma and allow to understand how the silencing of DcR1 and DcR2 is related to melanomagenesis.
23584885 The membrane expression of the TRAIL receptors DR4, DR5, DcR1 and DcR2 is greater in normal endometrium than endometrioid adenocarcinoma (EAC). The level of the receptors in EAC is not dependent on grading and staging and does not predict survival.
23333304 HIV-1 Vif upregulates the expression of tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain (TNFRSF10D) in Vif-expression T cells
22028813 transcript levels of UCHL1, COL1A2, THBS1 and TNFRSF10D were inversely correlated with promoter methylation
21483669 HIV-1 Vif upregulates the expression of tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain (TNFRSF10D) in Vif-expression T cells
More...

AA Sequence

MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPRQDEVPQQTVA      1 - 70
PQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQ     71 - 140
CEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPY    141 - 210
HYLIIIVVLVIILAVVVVGFSCRKKFISYLKGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETL    211 - 280
SNRYLQPTQVSEQEIQGQELAELTGVTVESPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDAS    281 - 350
ATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL                                      351 - 386
//

Text Mined References (55)

PMID Year Title
26542757 2016 Epigenetic inactivation of TRAIL decoy receptors at 8p12-21.3 commonly deleted region confers sensitivity to Apo2L/trail-Cisplatin combination therapy in cervical cancer.
26050621 2016 Decoy receptors block TRAIL sensitivity at a supracellular level: the role of stromal cells in controlling tumour TRAIL sensitivity.
25003639 2014 Association of TNFRSF10D DNA-methylation with the survival of melanoma patients.
24649804 2014 Membrane expression of trail receptors DcR1 and DcR2 in the normal endometrium, endometrial atypical hyperplasia and endometrioid endometrial cancer.
24211571 2013 Impact of DNA methyltransferases on the epigenetic regulation of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor expression in malignant melanoma.
23584885 2013 Membrane expression of TRAIL receptors DR4, DR5, DcR1 and DcR2 in the normal endometrium, atypical endometrial hyperplasia and endometrioid adenocarcinoma: a tissue microarray study.
22028813 2011 Cross-platform array screening identifies COL1A2, THBS1, TNFRSF10D and UCHL1 as genes frequently silenced by methylation in melanoma.
20875141 2010 Short-hairpin RNA-induced suppression of adenine nucleotide translocase-2 in breast cancer cells restores their susceptibility to TRAIL-induced apoptosis by activating JNK and modulating TRAIL receptor expression.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20799941 2010 TRAIL death receptor-4, decoy receptor-1 and decoy receptor-2 expression on CD8+ T cells correlate with the disease severity in patients with rheumatoid arthritis.
More...