Property Summary

NCBI Gene PubMed Count 53
Grant Count 114
R01 Count 57
Funding $11,334,780.65
PubMed Score 180.22
PubTator Score 125.89

Knowledge Summary

Patent (5,465)

Expression

Synonym

Gene

PANTHER Protein Class (2)

Gene RIF (37)

PMID Text
26755577 slow phase of Gi/o-mediated TRPC4 activation was diminished by inhibiting RhoA or enhancing PLCdelta function
26083271 Studies indicate potential roles for Rasd1 small G protein and leptin in TRPC4 cation channel activation.
25788576 Galpha(i2) activates the TRPC4 channel by direct binding.
25476892 This study identifies a novel role for TRPC4 in the regulation of autophagy in vascular endothelial cells.
25349210 a membrane-targeting domain of the transient receptor potential canonical (TRPC)4 channel unrelated to its formation of a tetrameric structure
24603752 The higher amplitude of store-operated Ca2+ entry was associated to the over-expression for Stim2, Orai2-3, and TRPC1 while Stim2 levels remained constant and Stim1, Orai1, Orai3, TRPC1 and TRPC4 proteins were over-expressed in primary myelofibrosis.
24563462 Tarbp2 binding to TRPC4 promotes changes of cytosolic Ca(2+) and, thereby, leads to a dynamic regulation of Dicer activity, essentially at low endogenous Dicer concentrations.
23677990 the S4-S5 linker is a critical constituent of TRPC4/C5 channel gating and that disturbance of its sequence allows channel opening independent of any sensor domain.
23549783 the enhanced apoptosis caused by the simultaneous depletion of Dp53 and Dmp52 is absolutely JNK-dependent.
22457348 an essential role of Galpha(i) proteins as novel activators for TRPC4/5 and reveal the molecular mechanism by which G-proteins activate the channels.
More...

AA Sequence

MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLG      1 - 70
RTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFT     71 - 140
PDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIA    141 - 210
LSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEE    211 - 280
QSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIA    281 - 350
PKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ    351 - 420
MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEALFAIANIFSSL    421 - 490
RLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIRCEKQNNA    491 - 560
FSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADH    561 - 630
ADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTHLCKKKMRRKPESFGTIGRRAADNL    631 - 700
RRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLSTIQSANASKE    701 - 770
SSNSADSDEKSDSEGNSKDKKKNFSLFDLTTLIHPRSAAIASERHNISNGSALVVQEPPREKQRKVNFVT    771 - 840
DIKNFGLFHRRSKQNAAEQNANQIFSVSEEVARQQAAGPLERNIQLESRGLASRGDLSIPGLSEQCVLVD    841 - 910
HRERNTDTLGLQVGKRVCPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL       911 - 977
//

Text Mined References (57)

PMID Year Title
26755577 2016 Critical roles of Gi/o proteins and phospholipase C-?1 in the activation of receptor-operated TRPC4 channels.
26083271 2015 The Roles of Rasd1 small G proteins and leptin in the activation of TRPC4 transient receptor potential channels.
25788576 2015 Close spatio-association of the transient receptor potential canonical 4 (TRPC4) channel with G?i in TRPC4 activation process.
25476892 2015 Novel role for TRPC4 in regulation of macroautophagy by a small molecule in vascular endothelial cells.
25349210 2014 Identification of a membrane-targeting domain of the transient receptor potential canonical (TRPC)4 channel unrelated to its formation of a tetrameric structure.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24603752 2014 Enhanced expression of Stim, Orai, and TRPC transcripts and proteins in endothelial progenitor cells isolated from patients with primary myelofibrosis.
24563462 2014 Trans-activation response (TAR) RNA-binding protein 2 is a novel modulator of transient receptor potential canonical 4 (TRPC4) protein.
23677990 2013 Conserved gating elements in TRPC4 and TRPC5 channels.
23549783 2013 During post-natal human myogenesis, normal myotube size requires TRPC1- and TRPC4-mediated Ca²? entry.
More...