Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.95
PubTator Score 0.51

Knowledge Summary

Patent (593)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 1.93710759468646E-12
lung carcinoma 2844 3.90996385738381E-11
pilocytic astrocytoma 3086 2.42101520537337E-6
psoriasis 6685 4.98167549200238E-5
glioblastoma 5572 0.00103498065614657
pediatric high grade glioma 2712 0.00103645404668806
oligodendroglioma 2849 0.0135393844420238
primitive neuroectodermal tumor 3031 0.0239856496706424
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 1.0
Disease Target Count Z-score Confidence
Childhood absence epilepsy 7 3.71 1.9

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma 2.000 0.014
psoriasis 2.700 0.000
osteosarcoma 4.192 0.000
glioblastoma 1.700 0.001
primitive neuroectodermal tumor 1.700 0.024
pediatric high grade glioma 1.400 0.001
pilocytic astrocytoma 2.300 0.000
lung carcinoma -1.100 0.000

Synonym

Accession Q9UBN1 B2RCK0
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

  TechDev Info (2)

Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available
Susumu Tomita phenotype in mouse

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20378664 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
14505496 examined distribution of the stargazin-like proteins gamma2, gamma3, and gamma4 in human CNS: gamma2 is expressed in cerebellum, cerebral cortex, hippocampus and thalamus, whereas gamma3 abounds in cerebral cortex & amygdala and gamma4 in basal ganglia

AA Sequence

MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVC      1 - 70
CIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLLGGLCIGAGRIYSRKNNIVLS     71 - 140
AGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYIEKN    141 - 210
KELRFKTKREFLKASSSSPYARMPSYRYRRRRSRSSSRSTEASPSRDVSPMGLKITGAIPMGELSMYTLS    211 - 280
REPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV                           281 - 327
//

Text Mined References (13)

PMID Year Title
21172611 2010 Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18304745 2009 Functional modulation of AMPA receptors by transmembrane AMPA receptor regulatory proteins.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14505496 2003 Human neuronal stargazin-like proteins, gamma2, gamma3 and gamma4; an investigation of their specific localization in human brain and their influence on CaV2.1 voltage-dependent calcium channels expressed in Xenopus oocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...