Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.02
PubTator Score 0.51

Knowledge Summary

Patent (593)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.1
Disease Target Count Z-score Confidence
Childhood absence epilepsy 8 3.652 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 2.400 2.1e-06
glioblastoma 1.100 6.9e-03
lung carcinoma -1.100 3.9e-11
oligodendroglioma 2.000 1.4e-02
osteosarcoma 4.192 1.9e-12
pediatric high grade glioma 1.400 1.0e-03
primitive neuroectodermal tumor 1.700 2.4e-02
psoriasis 2.700 5.0e-05

Protein-protein Interaction (9)

Gene RIF (5)

AA Sequence

MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVC      1 - 70
CIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLLGGLCIGAGRIYSRKNNIVLS     71 - 140
AGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYIEKN    141 - 210
KELRFKTKREFLKASSSSPYARMPSYRYRRRRSRSSSRSTEASPSRDVSPMGLKITGAIPMGELSMYTLS    211 - 280
REPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV                           281 - 327
//

Text Mined References (14)

PMID Year Title