Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1063.19
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic -1.600 4.0e-05
atypical teratoid/rhabdoid tumor -1.200 1.5e-02
ependymoma -1.300 3.9e-04
glioblastoma -1.300 1.1e-03
group 3 medulloblastoma -1.400 4.8e-02
lung carcinoma 2.200 3.5e-13
non primary Sjogren syndrome sicca -1.300 2.4e-02
ovarian cancer -1.200 5.2e-06
pediatric high grade glioma -1.100 1.7e-02
pituitary cancer -1.100 4.4e-02

Gene RIF (14)

AA Sequence

MFKFHQMKHIFEILDKMRCLRKRSTVSFLGVLVIFLLFMNLYIEDSYVLEGDKQLIRETSTHQLNSERYV      1 - 70
HTFKDLSNFSGAINVTYRYLAATPLQRKRYLTIGLSSVKRKKGNYLLETIKSIFEQSSYEELKEISVVVH     71 - 140
LADFNSSWRDAMVQDITQKFAHHIIAGRLMVIHAPEEYYPILDGLKRNYNDPEDRVKFRSKQNVDYAFLL    141 - 210
NFCANTSDYYVMLEDDVRCSKNFLTAIKKVIASLEGTYWVTLEFSKLGYIGKLYHSHDLPRLAHFLLMFY    211 - 280
QEMPCDWLLTHFRGLLAQKNVIRFKPSLFQHMGYYSSYKGTENKLKDDDFEEESFDIPDNPPASLYTNMN    281 - 350
VFENYEASKAYSSVDEYFWGKPPSTGDVFVIVFENPIIIKKIKVNTGTEDRQNDILHHGALDVGENVMPS    351 - 420
KQRRQCSTYLRLGEFKNGNFEMSGVNQKIPFDIHCMRIYVTKTQKEWLIIRSISIWTS                421 - 478
//

Text Mined References (11)

PMID Year Title