Property Summary

NCBI Gene PubMed Count 19
Grant Count 88
R01 Count 23
Funding $27,329,735.67
PubMed Score 31.95
PubTator Score 32.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.200 0.001

Synonym

Accession Q9UBM4 Q5T2G4
Symbols OPT

Gene

PANTHER Protein Class (1)

Gene RIF (11)

PMID Text
22669977 opticin binds to collagen and thereby competitively inhibits endothelial cell interactions with collagen via alpha(1)beta(1) and alpha(2)beta(1) integrins, thereby preventing the strong adhesion that is required for proangiogenic signaling via these integrins.
22534113 VEGF and hypoxia could decrease opticin protein levels in the human retinal pigment epithelium secretome, and that opticin may be an enzymatic substrate for MMP-2.
22082156 Knockdown of opticin (OPTC) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19844586 OPTC and EPYC are unlikely to play a major role in high myopia.
19844586 Observational study of gene-disease association. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
17563717 Observational study of gene-disease association. (HuGE Navigator)
17359525 Observational study of gene-disease association. (HuGE Navigator)
17359525 OPTC is a candidate gene for primary open-angle glaucoma
More...

AA Sequence

MRLLAFLSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTD      1 - 70
YGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGLLLSSQPNHGLPTCLVCVCLGSSVYC     71 - 140
DDIDLEDIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLKRIDLSNNLISSIDNDAFRLLHALQDLILPE    141 - 210
NQLEALPVLPSGIEFLDVRLNRLQSSGIQPAAFRAMEKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLI    211 - 280
ETMQRDVFCDPEEHKHTRRQLEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT                      281 - 332
//

Text Mined References (20)

PMID Year Title
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22669977 2012 Opticin exerts its anti-angiogenic activity by regulating extracellular matrix adhesiveness.
22534113 2012 Opticin production is reduced by hypoxia and VEGF in human retinal pigment epithelium via MMP-2 activation.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19844586 2009 An evaluation of OPTC and EPYC as candidate genes for high myopia.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
17563717 2007 Role of CYP1B1, MYOC, OPTN, and OPTC genes in adult-onset primary open-angle glaucoma: predominance of CYP1B1 mutations in Indian patients.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17359525 2007 Evaluation of the OPTC gene in primary open angle glaucoma: functional significance of a silent change.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...