Property Summary

NCBI Gene PubMed Count 59
PubMed Score 89.88
PubTator Score 90.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (44)

AA Sequence

MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTILLLNFLRSHC      1 - 70
FTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGDYFGILKEARVTVFPFNILDN     71 - 140
PMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS               141 - 199
//

Text Mined References (63)

PMID Year Title