Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.49
PubTator Score 2.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 0.000

Synonym

Accession Q9UBL6
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
25453951 These results suggest Cpne7 is a diffusible signaling molecule that is secreted by preameloblasts, and regulates the differentiation of mesenchymal cells of dental or non-dental origin into odontoblasts.

AA Sequence

MSAGSERGAAATPGGLPAPCASKVELRLSCRHLLDRDPLTKSDPSVALLQQAQGQWVQVGRTEVVRSSLH      1 - 70
PVFSKVFTVDYYFEEVQRLRFEVYDTHGPSGFSCQEDDFLGGMECTLGQPAQKWLLQVVMRVSVDVLGPA     71 - 140
GHCAKHFLCCTESSHLARTGPSFLLRYDDLCLPWATAGAVRWWTCRGGHTQGWQIVAQKKVTRPLLLKFG    141 - 210
RNAGKSTITVIAEDISGNNGYVELSFRARKLDDKDLFSKSDPFLELYRVNDDQGLQLVYRTEVVKNNLNP    211 - 280
VWEAFKVSLSSLCSCEETRPLKCLVWDYDSRGKHDFIGEFSTTFEEMQKAFEEGQAQWDCVNPKYKQKRR    281 - 350
SYKNSGVVVLADLKFHRVYSFLDYIMGGCQIHFTVAIDFTASNGDPRNSCSLHYINPYQPNEYLKALVSV    351 - 420
GEICQDYDSDKRFSALGFGARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPRVQLYGPTNVAP    421 - 490
IISKVARVAAAEESTGKASQYYILLILTDGVVTDMADTREAIVRASRLPMSIIIVGVGNADFTDMQVLDG    491 - 560
DDGVLRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEYYSHRGLPPRSLGVPAGEASPG    561 - 630
CTP                                                                       631 - 633
//

Text Mined References (10)

PMID Year Title
25453951 2015 CPNE7, a preameloblast-derived factor, regulates odontoblastic differentiation of mesenchymal stem cells.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21087455 2010 Copines-1, -2, -3, -6 and -7 show different calcium-dependent intracellular membrane translocation and targeting.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12949241 2003 Tissue expression of copines and isolation of copines I and III from the cytosol of human neutrophils.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10534407 1999 Characterization of copine VII, a new member of the copine family, and its exclusion as a candidate in sporadic breast cancers with loss of heterozygosity at 16q24.3.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.