Property Summary

NCBI Gene PubMed Count 46
Grant Count 32
R01 Count 20
Funding $1,845,146.16
PubMed Score 32.46
PubTator Score 46.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.582 0.000

 GWAS Trait (1)

Gene RIF (18)

PMID Text
25996283 the histone methyltransferase core enzyme ASH2L was bound at EGFR in the germinal matrix and in gliomas where levels of H3K4me3 are high, and the histone acetyltransferase P300 was bound in samples with H3K27ac enrichment
25258321 ASH2L enhances ERalpha expression as a coactivator of GATA3 in breast cancers
25023704 Ash2L acts in concert with P53 promoter occupancy to activate RNA Polymerase II by aiding formation of a stable transcription pre-initiation complex required for its activation.
24680668 Non active site mutations in the MLL1 SET domain render the protein defective for H3K4 dimethylation by the MLL1 core complex, which is associated with a loss of the ability of MLL1 to interact with WRAD or with the RbBP5/Ash2L heterodimer.
24235145 Data indicate that MLL1 methylates Ash2L in the absence of histone H3, but only when assembled within a complex with WDR5 and RbBP5.
23453805 H2B dependent regulation of MLL family histone methylatransferases depends on the N-terminal WH motif of ASH2L.
22231628 crystal structure of the C-terminal SPRY domain of human Ash2L
21660059 The structure shows that Ash2L contains an atypical PHD finger that does not have histone tail-binding activity.
21642971 ASH2L binds DNA using a forkhead-like helix-wing-helix (HWH) domain.
21445285 NF-Y acts upstream of H3K4me3 deposition by recruiting Ash2L
More...

AA Sequence

MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDV      1 - 70
SGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFM     71 - 140
TNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTT    141 - 210
RQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTS    211 - 280
GNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDP    281 - 350
HAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGA    351 - 420
WYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYI    421 - 490
NLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEG    491 - 560
VYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP      561 - 628
//

Text Mined References (53)

PMID Year Title
25996283 2015 EGFR promoter exhibits dynamic histone modifications and binding of ASH2L and P300 in human germinal matrix and gliomas.
25416956 2014 A proteome-scale map of the human interactome network.
25258321 2014 Absent, small or homeotic 2-like protein (ASH2L) enhances the transcription of the estrogen receptor ? gene through GATA-binding protein 3 (GATA3).
25023704 2015 Ash2L enables P53-dependent apoptosis by favoring stable transcription pre-initiation complex formation on its pro-apoptotic target promoters.
24680668 2014 A non-active-site SET domain surface crucial for the interaction of MLL1 and the RbBP5/Ash2L heterodimer within MLL family core complexes.
24235145 2014 Automethylation activities within the mixed lineage leukemia-1 (MLL1) core complex reveal evidence supporting a "two-active site" model for multiple histone H3 lysine 4 methylation.
23870121 2013 SET1 and p300 act synergistically, through coupled histone modifications, in transcriptional activation by p53.
23453805 2013 ASH2L regulates ubiquitylation signaling to MLL: trans-regulation of H3 K4 methylation in higher eukaryotes.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23307926 2013 A genome-wide association study of early menopause and the combined impact of identified variants.
More...