Property Summary

NCBI Gene PubMed Count 35
PubMed Score 21.82
PubTator Score 24.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
ovarian cancer 8492 1.34168140578157E-5
Multiple myeloma 1328 3.85193350473049E-5
group 3 medulloblastoma 2254 6.21566472220289E-4
diabetes mellitus 1663 0.00104821351867176
Waldenstrons macroglobulinemia 765 0.00133139665441034
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis type 2 1 4.657 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.245 0.001
Multiple myeloma 1.772 0.000
diabetes mellitus -1.700 0.001
group 3 medulloblastoma 1.400 0.001
ovarian cancer -1.700 0.000

Synonym

Accession Q9UBK9 B2R561 Q5JZG3 Q9Y6E5
Symbols STAP1
ART-27

Gene

UXT

  Ortholog (10)

Gene RIF (20)

PMID Text
25974965 we describe the identification of UXT as a novel MDMX-interacting protein
25434787 UXT is a binding protein of PIAS2, and interaction between PIAS2 and UXT may be important for the transcriptional activation of AR.
24743694 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24136450 Knockdown of UXT expression in Treg cells results in a less-suppressive phenotype.
24021647 Data found that the UXT isoforms elicit dual opposing regulatory effects on SARM-induced apoptosis.
23961993 VHL-UXT interaction and VHL-induced ubiquitination of androgen receptor(AR) regulate transcriptional activation of the AR.
22933289 Epstein-Barr virus BGLF4 kinase downregulates NF-kappaB transactivation through phosphorylation of coactivator UXT
22131337 UXT-V1 represents a novel integral component of the MAVS signalosome on mitochondria, mediating the innate antiviral signal transduction.
21907703 these results suggest that Als2 is a binding partner of Uxt and Als2/Uxt interaction could be important for the activation of Nf-kappaB pathway.
21730289 Data show that while Art-27 can bind AR directly, URI is bound to chromatin prior to hormone-dependent recruitment of AR, suggesting a role for URI in modulating AR recruitment to target genes.
More...

AA Sequence

MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQ      1 - 70
VDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLE     71 - 140
GLRELQGLQNFPEKPHH                                                         141 - 157
//

Text Mined References (37)

PMID Year Title
25974965 2015 UXT, a novel MDMX-binding protein, promotes glycolysis by mitigating p53-mediated restriction of NF-?B activity.
25434787 2015 Ubiquitously expressed transcript is a novel interacting protein of protein inhibitor of activated signal transducer and activator of transcription 2.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24743694 2014 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24136450 2014 UXT is a novel regulatory factor of regulatory T cells associated with Foxp3.
24021647 2013 UXT plays dual opposing roles on SARM-induced apoptosis.
23961993 2013 Regulation of the transcriptional activation of the androgen receptor by the UXT-binding protein VHL.
22933289 2012 Epstein-Barr virus BGLF4 kinase downregulates NF-?B transactivation through phosphorylation of coactivator UXT.
22131337 2012 UXT-V1 facilitates the formation of MAVS antiviral signalosome on mitochondria.
More...