Property Summary

NCBI Gene PubMed Count 39
PubMed Score 23.76
PubTator Score 24.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.3e-05
Multiple myeloma 1332 3.9e-05
group 3 medulloblastoma 4104 6.2e-04
diabetes mellitus 1728 1.0e-03
Waldenstrons macroglobulinemia 765 1.3e-03
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis type 2 3 4.547 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.700 1.0e-03
group 3 medulloblastoma 1.400 6.2e-04
Multiple myeloma 1.772 3.9e-05
ovarian cancer -1.700 1.3e-05
Waldenstrons macroglobulinemia 1.245 1.3e-03

Gene RIF (22)

AA Sequence

MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQ      1 - 70
VDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLE     71 - 140
GLRELQGLQNFPEKPHH                                                         141 - 157
//

Text Mined References (41)

PMID Year Title