Property Summary

NCBI Gene PubMed Count 35
Grant Count 16
R01 Count 12
Funding $909,525.28
PubMed Score 21.82
PubTator Score 24.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.245 0.001
Multiple myeloma 1.772 0.000
diabetes mellitus -1.700 0.001
group 3 medulloblastoma 1.400 0.001
ovarian cancer -1.700 0.000

Gene RIF (20)

PMID Text
25974965 we describe the identification of UXT as a novel MDMX-interacting protein
25434787 UXT is a binding protein of PIAS2, and interaction between PIAS2 and UXT may be important for the transcriptional activation of AR.
24743694 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24136450 Knockdown of UXT expression in Treg cells results in a less-suppressive phenotype.
24021647 Data found that the UXT isoforms elicit dual opposing regulatory effects on SARM-induced apoptosis.
23961993 VHL-UXT interaction and VHL-induced ubiquitination of androgen receptor(AR) regulate transcriptional activation of the AR.
22933289 Epstein-Barr virus BGLF4 kinase downregulates NF-kappaB transactivation through phosphorylation of coactivator UXT
22131337 UXT-V1 represents a novel integral component of the MAVS signalosome on mitochondria, mediating the innate antiviral signal transduction.
21907703 these results suggest that Als2 is a binding partner of Uxt and Als2/Uxt interaction could be important for the activation of Nf-kappaB pathway.
21730289 Data show that while Art-27 can bind AR directly, URI is bound to chromatin prior to hormone-dependent recruitment of AR, suggesting a role for URI in modulating AR recruitment to target genes.
More...

AA Sequence

MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQ      1 - 70
VDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLE     71 - 140
GLRELQGLQNFPEKPHH                                                         141 - 157
//

Text Mined References (37)

PMID Year Title
25974965 2015 UXT, a novel MDMX-binding protein, promotes glycolysis by mitigating p53-mediated restriction of NF-?B activity.
25434787 2015 Ubiquitously expressed transcript is a novel interacting protein of protein inhibitor of activated signal transducer and activator of transcription 2.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24743694 2014 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24136450 2014 UXT is a novel regulatory factor of regulatory T cells associated with Foxp3.
24021647 2013 UXT plays dual opposing roles on SARM-induced apoptosis.
23961993 2013 Regulation of the transcriptional activation of the androgen receptor by the UXT-binding protein VHL.
22933289 2012 Epstein-Barr virus BGLF4 kinase downregulates NF-?B transactivation through phosphorylation of coactivator UXT.
22131337 2012 UXT-V1 facilitates the formation of MAVS antiviral signalosome on mitochondria.
More...