Property Summary

NCBI Gene PubMed Count 318
PubMed Score 307.54
PubTator Score 385.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
malignant mesothelioma 3232 8.3e-07
ovarian cancer 8520 1.0e-05
osteosarcoma 7950 6.9e-05
lung cancer 4740 7.1e-03
colon cancer 1478 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.100 1.4e-02
lung cancer -1.300 7.1e-03
malignant mesothelioma 1.700 8.3e-07
osteosarcoma 1.824 6.9e-05
ovarian cancer -1.400 1.0e-05

Gene RIF (346)

AA Sequence

MGAASVRAGARLVEVALCSFTVTCLEVMRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDK      1 - 70
YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDK     71 - 140
RLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLVKSE    141 - 210
LLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASLNIPGLPPEYLQVH    211 - 280
LQESLGQEESQVSVTSADPVFQVPISKAVQLTTNDAIKTTLLVELDISNTDFSYQPGDAFSVICPNSDSE    281 - 350
VQSLLQRLQLEDKREHCVLLKIKADTKKKGATLPQHIPAGCSLQFIFTWCLEIRAIPKKAFLRALVDYTS    351 - 420
DSAEKRRLQELCSKQGAADYSRFVRDACACLLDLLLAFPSCQPPLSLLLEHLPKLQPRPYSCASSSLFHP    421 - 490
GKLHFVFNIVEFLSTATTEVLRKGVCTGWLALLVASVLQPNIHASHEDSGKALAPKISISPRTTNSFHLP    491 - 560
DDPSIPIIMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHGILT    561 - 630
HLKVSFSRDAPVGEEEAPAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDVHDALVQIISKEVG    631 - 700
VEKLEAMKTLATLKEEKRYLQDIWS                                                 701 - 725
//

Text Mined References (322)

PMID Year Title