Property Summary

NCBI Gene PubMed Count 305
Grant Count 86
R01 Count 71
Funding $9,291,761.09
PubMed Score 259.13
PubTator Score 385.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
osteosarcoma 1.824 0.000
lung cancer -2.200 0.000
colon cancer 1.100 0.014
ovarian cancer -1.400 0.000

Synonym

Accession Q9UBK8 O60471 Q32MA9 Q7Z4M8 MSR
Symbols MSR
cblE

Gene

PDB

2QTL   2QTZ  

Gene RIF (334)

PMID Text
26345779 We aimed to explore the correlation between unexplained recurrent spontaneous abortion and polymorphisms in the methylene tetrahydrofolate reductase (MTHFR) and methionine synthase reductase (MTRR) genes.
26337056 Low folate status and homocysteine metabolism gene polymorphisms (MTHFR C677T, MTHFR A1298C, MTR A2756G and MTRR A66G) may have a synergistic effect towards increasing the incidence of dyslipidemia in Chinese hypertensive population.
26334892 Methionine synthase (MTR) and methionine synthase reductase (MTRR) polymorphisms were significantly associated with the increased neural tube defects risk in a Chinese population.
26316272 an association between MTRR 66 and SHMT1 1420 polymorphisms and spaceflight-induced vision changes
26266420 interactions among homocysteine metabolism gene polymorphisms in MTHFR, MTR and MTRR lead to dramatic elevations in the folate deficiency risk
26252105 MSR 524C/T polymorphism is associated with essential hypertension in ethnic groups in China.
26214647 Review/Meta-analysis: suggest an association between MTRR A66G polymorphism and colorectal cancer susceptibility among Caucasians.
26196053 no association of rs1801394 with non-obstructive azoospermia
26154858 polymorphisms of the MTHFR, MTRR, and MTR enzymes are well documented as folate deficiency-related disorders. The aim of this study was to compare the genotypic distribution of these gene polymorphisms between patients with acromegaly and controls.
26090795 Variation in MTHFR, MTR, and MTRR were significantly associated with percent LINE-1 methylation.DNA methylation of LINE-1 elements in histologically normal breast tissues is influenced by polymorphisms in genes in the one-carbon metabolism pathway
More...

AA Sequence

MGAASVRAGARLVEVALCSFTVTCLEVMRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDK      1 - 70
YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDK     71 - 140
RLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLVKSE    141 - 210
LLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASLNIPGLPPEYLQVH    211 - 280
LQESLGQEESQVSVTSADPVFQVPISKAVQLTTNDAIKTTLLVELDISNTDFSYQPGDAFSVICPNSDSE    281 - 350
VQSLLQRLQLEDKREHCVLLKIKADTKKKGATLPQHIPAGCSLQFIFTWCLEIRAIPKKAFLRALVDYTS    351 - 420
DSAEKRRLQELCSKQGAADYSRFVRDACACLLDLLLAFPSCQPPLSLLLEHLPKLQPRPYSCASSSLFHP    421 - 490
GKLHFVFNIVEFLSTATTEVLRKGVCTGWLALLVASVLQPNIHASHEDSGKALAPKISISPRTTNSFHLP    491 - 560
DDPSIPIIMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHGILT    561 - 630
HLKVSFSRDAPVGEEEAPAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDVHDALVQIISKEVG    631 - 700
VEKLEAMKTLATLKEEKRYLQDIWS                                                 701 - 725
//

Text Mined References (309)

PMID Year Title
26345779 2015 Polymorphisms in the methylene tetrahydrofolate reductase and methionine synthase reductase genes and their correlation with unexplained recurrent spontaneous abortion susceptibility.
26337056 2015 Joint associations of folate, homocysteine and MTHFR, MTR and MTRR gene polymorphisms with dyslipidemia in a Chinese hypertensive population: a cross-sectional study.
26334892 2015 Analysis of MTR and MTRR Polymorphisms for Neural Tube Defects Risk Association.
26316272 2016 Genotype, B-vitamin status, and androgens affect spaceflight-induced ophthalmic changes.
26266420 2015 Homocysteine Metabolism Gene Polymorphisms (MTHFR C677T, MTHFR A1298C, MTR A2756G and MTRR A66G) Jointly Elevate the Risk of Folate Deficiency.
26252105 2015 [Association of plasma homocysteine level and polymorphism of methione synthase reductase gene with essential hypertension in ethnic Uyghurs and Hans from Xinjiang].
26214647 A meta-analysis of MTRR A66G polymorphism and colorectal cancer susceptibility.
26196053 2015 Association between genetic polymorphisms in folate-related enzyme genes and infertile men with non-obstructive azoospermia.
26154858 2015 An Association Study Between Gene Polymorphisms of Folic Acid Metabolism Enzymes and Biochemical and Hormonal Parameters in Acromegaly.
26090795 2015 Associations between genetic variation in one-carbon metabolism and LINE-1 DNA methylation in histologically normal breast tissues.
More...