Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.02
PubTator Score 3.55

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24825419 Suggest the 114391996 delC allele in the RABL2A gene may act as a risk factor for oligoasthenospermic infertility in Australian men.
20138207 In human samples no deviations of the euploid genomic state could be detected indicating that 22q13 microdeletions involving RABL2B are rare.

AA Sequence

MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTI      1 - 70
LVDFWDTAGQERFQSMHASYYHKAHACIMVFDIQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINV     71 - 140
TQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQ    141 - 210
EQSSSIETPSEEVASPHS                                                        211 - 228
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24825419 2014 Genetic variants in the RABL2A gene in fertile and oligoasthenospermic infertile men.
23055941 2012 RAB-like 2 has an essential role in male fertility, sperm intra-flagellar transport, and tail assembly.
20138207 2010 Analysis of relative gene dosage and expression differences of the paralogs RABL2A and RABL2B by Pyrosequencing.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10444334 1999 Two novel human RAB genes with near identical sequence each map to a telomere-associated region: the subtelomeric region of 22q13.3 and the ancestral telomere band 2q13.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.