Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.67
PubTator Score 3.55

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UBK7 B7ZBD6 Q9NU37
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (2)

AA Sequence

MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTI      1 - 70
LVDFWDTAGQERFQSMHASYYHKAHACIMVFDIQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINV     71 - 140
TQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQ    141 - 210
EQSSSIETPSEEVASPHS                                                        211 - 228
//

Text Mined References (10)

PMID Year Title