Property Summary

NCBI Gene PubMed Count 23
PubMed Score 59.01
PubTator Score 50.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial cystitis 1.300 5.6e-04
intraductal papillary-mucinous carcinoma... -1.100 9.5e-05
lung carcinoma -1.200 1.3e-11
non-small cell lung cancer -1.205 2.0e-15
osteosarcoma -1.226 1.3e-02
tuberculosis 1.300 7.0e-08

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFL      1 - 70
CARPRRSPAQEDGKVYINMPGRG                                                    71 - 93
//

Text Mined References (32)

PMID Year Title