Property Summary

NCBI Gene PubMed Count 23
Grant Count 66
R01 Count 35
Funding $5,695,737.06
PubMed Score 52.78
PubTator Score 50.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.226 0.013
tuberculosis 1.300 0.000
non-small cell lung cancer -1.205 0.000
intraductal papillary-mucinous carcinoma... -1.100 0.000
interstitial cystitis 1.300 0.001
lung carcinoma -1.200 0.000

Synonym

Accession Q9UBK5 Q9UBS1 Q9Y3Y0
Symbols DAP10
KAP10
PIK3AP

Gene

Gene RIF (11)

PMID Text
26508790 These results suggest that NKG2D-DAP10 endocytosis represents a means to decrease cell surface receptor abundance, as well as to control signaling outcome in cytotoxic lymphocytes.
25002577 findings indicate that the functional interaction between RAGE and DAP10 coordinately regulates S100A8/A9-mediated survival and/or apoptotic response of keratinocytes
22438812 TGF-beta1 may reduce the expression of NKG2D/DAP10 and 2B4/SAPin patients with hepatitis B.
21816829 Other gamma(c) cytokines act similarly to IL-2 in up-regulating DAP10 expression and NKG2D-DAP10 surface expression.
21789015 TGF-BETA1 down-modulates surface NKG2D expression by controlling the transcriptional and translational levels of DAP10.
21706044 HMBOX1 negatively regulates the expression of NKG2D and the activation of the NKG2D/DAP10 signaling pathway in NK cells.
21263069 A transgenic mouse model demonstrates that induction of tolerance in Ly49H-positive natural killer (NK) cells by chronic exposure to virus-encoded ligand m157 requires signaling through the Ly49H adaptor protein DAP12, not the DAP10 adaptor protein.
19329438 the rapid degradation of NKG2D/DAP10 observed coincident with recruitment of the receptor to the cytotoxic immune synapse may explain the loss of NKG2D receptor expression after chronic exposure to NKG2D ligands
19075187 Downstream targets of DAP10 and DAP12 are constitutively activated in large granular lymphocyte leukemia cells, and expression of dominant-negative DAP10 and DAP12 dramatically reduces their lytic capacity.
16339517 both activated and expanded CD8+ T cells and NK cells use DAP10 for cytolysis
More...

AA Sequence

MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFL      1 - 70
CARPRRSPAQEDGKVYINMPGRG                                                    71 - 93
//

Text Mined References (32)

PMID Year Title
26508790 2015 Ubiquitin-dependent endocytosis of NKG2D-DAP10 receptor complexes activates signaling and functions in human NK cells.
26221034 2015 Identification and Characterization of CD300H, a New Member of the Human CD300 Immunoreceptor Family.
25002577 2014 DNAX-activating protein 10 (DAP10) membrane adaptor associates with receptor for advanced glycation end products (RAGE) and modulates the RAGE-triggered signaling pathway in human keratinocytes.
22438812 2012 TGF-?1 down-regulation of NKG2D/DAP10 and 2B4/SAP expression on human NK cells contributes to HBV persistence.
21816829 2011 Complex regulation of human NKG2D-DAP10 cell surface expression: opposing roles of the ?c cytokines and TGF-?1.
21789015 A possible mechanism of impaired NK cytotoxicity in cancer patients: down-regulation of DAP10 by TGF-beta1.
21706044 2011 HMBOX1 negatively regulates NK cell functions by suppressing the NKG2D/DAP10 signaling pathway.
21263069 2011 Activation receptor-induced tolerance of mature NK cells in vivo requires signaling through the receptor and is reversible.
19329438 2009 The traffic of the NKG2D/Dap10 receptor complex during natural killer (NK) cell activation.
19075187 2009 A critical role for DAP10 and DAP12 in CD8+ T cell-mediated tissue damage in large granular lymphocyte leukemia.
More...