Property Summary

NCBI Gene PubMed Count 469
Grant Count 763
R01 Count 464
Funding $100,422,244.54
PubMed Score 687.51
PubTator Score 991.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q9UBK2 B7Z406 G8DM16 I3RTT5 I3RTT6 I3RTT7 I3RTT8 I3RTT9 Q3LIG1 Q4W5M7 Q9UN32 PGC-1-alpha
Symbols LEM6
PGC1
PGC1A
PGC-1v
PPARGC1
PGC-1alpha
PGC-1(alpha)

Gene

PDB

3B1M   3CS8   3U9Q   3V9T   3V9V   1XB7   3D24   4QJR   4QK4  

Gene RIF (482)

PMID Text
27456910 Combined speed endurance and endurance exercise amplify the exercise-induced PGC-1alpha and PDK4 mRNA response in trained human muscle.
27436584 Suggest that neither plasma adrenaline nor muscle metabolic stress determines the magnitude of PGC-1alpha mRNA response in exercising human muscle.
27143380 Blood PGC-1alpha concentration was higher in cardiovascular disease patients than that in healthy persons, and tended to decrease with age.
27033444 Novel angiogenic agent COA-Cl induced activation of PGC-1alpha/ERRalpha/VEGF signaling pathway in fibroblasts.
27022023 Methionine was the only essential amino acid that rapidly induced PGC-1alpha acetylation through activating the GCN5 acetyltransferase.
27015186 The PPARGC1A rs8192678 GA/AA genotype and the PNPLA3 rs738409 GG genotype had an additive effect on NASH in severely obese Taiwanese patients.
26982719 results implicate niacinamide and NAD (nicotinamide adenine dinucleotide) as key effectors for achieving PGC1alpha-dependent stress resistance
26962700 This study provides important insights into the metabolic changes associated with RPE functional maturation and identifies PGC-1alpha as a potent driver of RPE mitochondrial function and antioxidant capacity.
26831453 Although primarily a nuclear protein, Sirt1 deacetylation of PPARGC1A has been extensively implicated in metabolic control and mitochondrial biogenesis, which was proposed to partially underlie Sirt1 role in caloric restriction and impacts on longevity. (Review)
26797282 our results revealed that stimulation of mitochondrial biogenesis by carvedilol resulted in functional gain of the mitochondria by showing increased oxygen consumption and mitochondrial respiratory rate.
More...

AA Sequence

MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYN      1 - 70
NEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEE     71 - 140
PSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSEL    141 - 210
LKYLTTNDDPPHTKPTENRNSSRDKCTSKKKSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTI    211 - 280
ERTLSVELSGTAGLTPPTTPPHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPE    281 - 350
QSELYAQLSKSSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ    351 - 420
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADKTGELRDSDFS    421 - 490
NEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDSVSPPKSLFSQ    491 - 560
RPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCYYYESSHYRHRTHRNSPLYVRSRSRSPYSR    561 - 630
RPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVF    631 - 700
GEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDD    701 - 770
FDPASTKSKYDSLDFDSLLKEAQRSLRR                                              771 - 798
//

Text Mined References (472)

PMID Year Title
27456910 2016 Combined speed endurance and endurance exercise amplify the exercise-induced PGC-1? and PDK4 mRNA response in trained human muscle.
27436584 2016 Impact of adrenaline and metabolic stress on exercise-induced intracellular signaling and PGC-1? mRNA response in human skeletal muscle.
27143380 [The level of circulating PGC1a in cardiovascular disease].
27033444 2016 A key role of PGC-1? transcriptional coactivator in production of VEGF by a novel angiogenic agent COA-Cl in cultured human fibroblasts.
27022023 2016 The Methionine Transamination Pathway Controls Hepatic Glucose Metabolism through Regulation of the GCN5 Acetyltransferase and the PGC-1? Transcriptional Coactivator.
27015186 2016 Interactions of a PPARGC1A Variant and a PNPLA3 Variant Affect Nonalcoholic Steatohepatitis in Severely Obese Taiwanese Patients.
26982719 2016 PGC1? drives NAD biosynthesis linking oxidative metabolism to renal protection.
26962700 2016 PGC-1? Induces Human RPE Oxidative Metabolism and Antioxidant Capacity.
26831453 2016 Sirt1 and the Mitochondria.
26797282 2016 Carvedilol promotes mitochondrial biogenesis by regulating the PGC-1/TFAM pathway in human umbilical vein endothelial cells (HUVECs).
More...