Property Summary

NCBI Gene PubMed Count 521
PubMed Score 728.06
PubTator Score 991.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Atherosclerosis 291 0.0 0.8
Lymphoid leukemia 160 0.0 1.1
Motor neuron disease 49 0.0 1.9
Disease Target Count
Amyotrophic lateral sclerosis 451

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -1.300 4.5e-02
atypical teratoid / rhabdoid tumor -1.300 1.9e-02
colon cancer -2.200 2.3e-06
gastric carcinoma -1.800 4.4e-02
glioblastoma -1.700 4.4e-03
group 3 medulloblastoma -1.800 1.9e-03
interstitial lung disease -1.100 3.8e-02
intraductal papillary-mucinous adenoma (... 1.700 2.6e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.9e-03
lung adenocarcinoma -1.400 1.4e-08
lung cancer -4.200 3.2e-06
malignant mesothelioma 2.500 2.0e-07
medulloblastoma, large-cell -2.800 1.2e-06
nephrosclerosis -1.406 1.3e-02
non-small cell lung cancer -1.003 3.0e-11
osteosarcoma -1.136 9.6e-03
pediatric high grade glioma -1.300 4.7e-03
pituitary cancer -3.600 5.8e-10
posterior fossa group B ependymoma 1.400 5.1e-05
psoriasis -2.300 4.0e-13
ulcerative colitis -2.100 1.3e-06

Protein-protein Interaction (4)

Gene RIF (534)

AA Sequence

MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYN      1 - 70
NEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEE     71 - 140
PSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSEL    141 - 210
LKYLTTNDDPPHTKPTENRNSSRDKCTSKKKSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTI    211 - 280
ERTLSVELSGTAGLTPPTTPPHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPE    281 - 350
QSELYAQLSKSSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ    351 - 420
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADKTGELRDSDFS    421 - 490
NEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDSVSPPKSLFSQ    491 - 560
RPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCYYYESSHYRHRTHRNSPLYVRSRSRSPYSR    561 - 630
RPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVF    631 - 700
GEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDD    701 - 770
FDPASTKSKYDSLDFDSLLKEAQRSLRR                                              771 - 798
//

Text Mined References (524)

PMID Year Title