Property Summary

NCBI Gene PubMed Count 26
PubMed Score 43.07
PubTator Score 176.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
ductal carcinoma in situ -1.300 5.2e-03
group 3 medulloblastoma -1.800 1.0e-03
invasive ductal carcinoma -1.400 1.9e-02
posterior fossa group A ependymoma -1.100 3.4e-06

Protein-protein Interaction (2)

Gene RIF (18)

AA Sequence

MTHMLNAAADRVKWTRSSAAKRAACLVAAAYALKTLYPIIGKRLKQSGHGKKKAAAYPAAENTEILHCTE      1 - 70
TICEKPSPGVNADFFKQLLELRKILFPKLVTTETGWLCLHSVALISRTFLSIYVAGLDGKIVKSIVEKKP     71 - 140
RTFIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQTYYKVINMDGRLANPDQSL    141 - 210
TEDIMMFSQSVAHLYSNLTKPILDVMLTSYTLIQTATSRGASPIGPTLLAGLVVYATAKVLKACSPKFGK    211 - 280
LVAEEAHRKGYLRYVHSRIIANVEEIAFYRGHKVEMKQLQKSYKALADQMNLILSKRLWYIMIEQFLMKY    281 - 350
VWSSSGLIMVAIPIITATGFADGEDGQKQVMVSERTEAFTTARNLLASGADAIERIMSSYKEVTELAGYT    351 - 420
ARVYNMFWVFDEVKRGIYKRTAVIQESESHSKNGAKVELPLSDTLAIKGKVIDVDHGIICENVPIITPAG    421 - 490
EVVASRLNFKVEEGMHLLITGPNGCGKSSLFRILSGLWPVYEGVLYKPPPQHMFYIPQRPYMSLGSLRDQ    491 - 560
VIYPDSVDDMHDKGYTDQDLERILHNVHLYHIVQREGGWDAVMDWKDVLSGGEKQRMGMARMFYHKPKYA    561 - 630
LLDECTSAVSIDVEGKIFQAAKGAGISLLSITHRPSLWKYHTHLLQFDGEGGWRFEQLDTAIRLTLSEEK    631 - 700
QKLESQLAGIPKMQQRLNELCKILGEDSVLKTIKNEDETS                                  701 - 740
//

Text Mined References (28)

PMID Year Title