Property Summary

NCBI Gene PubMed Count 25
Grant Count 22
R01 Count 10
Funding $3,134,657.99
PubMed Score 41.32
PubTator Score 176.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.800 0.001
posterior fossa group A ependymoma -1.100 0.000
ductal carcinoma in situ -1.300 0.005
invasive ductal carcinoma -1.400 0.019

Gene RIF (17)

PMID Text
25604068 ABCD2 has a role, but not a strong one, in risk of early recurrent events after transient ischemic attack
25079382 13-cis-retinoic acid induces ABCD2 expression in human monocytes/macrophages.
24338191 results show that although patients with ABCD2 score greater than 4 were more likely to develop recurrent TIA/CVA in short term, those with lesser score still harbour a considerable risk for TIA/CVA
23437103 The transcriptional activity of the ABCD2 promoter was strongly increased by ectopic expression of beta-catenin and TCF-4.
21145416 HsABCD1 and HsABCD2 have distinct substrate specificities
20877624 Observational study of gene-disease association. (HuGE Navigator)
20661612 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18834860 These findings are of particular importance for the attempt of pharmacological induction of ABCD2 as a possible therapeutic approach in X-linked adrenoleukodystrophy.
18660489 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTHMLNAAADRVKWTRSSAAKRAACLVAAAYALKTLYPIIGKRLKQSGHGKKKAAAYPAAENTEILHCTE      1 - 70
TICEKPSPGVNADFFKQLLELRKILFPKLVTTETGWLCLHSVALISRTFLSIYVAGLDGKIVKSIVEKKP     71 - 140
RTFIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQTYYKVINMDGRLANPDQSL    141 - 210
TEDIMMFSQSVAHLYSNLTKPILDVMLTSYTLIQTATSRGASPIGPTLLAGLVVYATAKVLKACSPKFGK    211 - 280
LVAEEAHRKGYLRYVHSRIIANVEEIAFYRGHKVEMKQLQKSYKALADQMNLILSKRLWYIMIEQFLMKY    281 - 350
VWSSSGLIMVAIPIITATGFADGEDGQKQVMVSERTEAFTTARNLLASGADAIERIMSSYKEVTELAGYT    351 - 420
ARVYNMFWVFDEVKRGIYKRTAVIQESESHSKNGAKVELPLSDTLAIKGKVIDVDHGIICENVPIITPAG    421 - 490
EVVASRLNFKVEEGMHLLITGPNGCGKSSLFRILSGLWPVYEGVLYKPPPQHMFYIPQRPYMSLGSLRDQ    491 - 560
VIYPDSVDDMHDKGYTDQDLERILHNVHLYHIVQREGGWDAVMDWKDVLSGGEKQRMGMARMFYHKPKYA    561 - 630
LLDECTSAVSIDVEGKIFQAAKGAGISLLSITHRPSLWKYHTHLLQFDGEGGWRFEQLDTAIRLTLSEEK    631 - 700
QKLESQLAGIPKMQQRLNELCKILGEDSVLKTIKNEDETS                                  701 - 740
//

Text Mined References (27)

PMID Year Title
25604068 2015 Duration of symptom and ABCD2 score as predictors of risk of early recurrent events after transient ischemic attack: a hospital-based case series study.
25079382 2014 Evaluation of retinoids for induction of the redundant gene ABCD2 as an alternative treatment option in X-linked adrenoleukodystrophy.
24338191 2013 Value of ABCD2 in predicting early ischemic stroke in patients diagnosed with transient ischemic attack.
23437103 2013 ABCD2 is a direct target of ?-catenin and TCF-4: implications for X-linked adrenoleukodystrophy therapy.
21145416 2011 Differential substrate specificities of human ABCD1 and ABCD2 in peroxisomal fatty acid ?-oxidation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20661612 2011 Identification of novel SNPs of ABCD1, ABCD2, ABCD3, and ABCD4 genes in patients with X-linked adrenoleukodystrophy (ALD) based on comprehensive resequencing and association studies with ALD phenotypes.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18834860 2008 X-linked adrenoleukodystrophy phenotype is independent of ABCD2 genotype.
18772397 2008 Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
More...