Property Summary

NCBI Gene PubMed Count 25
PubMed Score 41.32
PubTator Score 176.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Colorectal Neoplasms 217
Disease Target Count P-value
posterior fossa group A ependymoma 1511 3.39019319083188E-6
group 3 medulloblastoma 2254 9.98164031848127E-4
ductal carcinoma in situ 1745 0.00523684320037523
invasive ductal carcinoma 2950 0.018695674323122
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Adrenoleukodystrophy 31 6.44 3.2
Peroxisomal disease 20 4.336 2.2

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.800 0.001
posterior fossa group A ependymoma -1.100 0.000
ductal carcinoma in situ -1.300 0.005
invasive ductal carcinoma -1.400 0.019

Synonym

Accession Q9UBJ2 B2RAM3 Q13210 Q2M3H9
Symbols ALDR
ABC39
ALDL1
ALDRP
hALDR

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (17)

PMID Text
25604068 ABCD2 has a role, but not a strong one, in risk of early recurrent events after transient ischemic attack
25079382 13-cis-retinoic acid induces ABCD2 expression in human monocytes/macrophages.
24338191 results show that although patients with ABCD2 score greater than 4 were more likely to develop recurrent TIA/CVA in short term, those with lesser score still harbour a considerable risk for TIA/CVA
23437103 The transcriptional activity of the ABCD2 promoter was strongly increased by ectopic expression of beta-catenin and TCF-4.
21145416 HsABCD1 and HsABCD2 have distinct substrate specificities
20877624 Observational study of gene-disease association. (HuGE Navigator)
20661612 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18834860 These findings are of particular importance for the attempt of pharmacological induction of ABCD2 as a possible therapeutic approach in X-linked adrenoleukodystrophy.
18660489 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTHMLNAAADRVKWTRSSAAKRAACLVAAAYALKTLYPIIGKRLKQSGHGKKKAAAYPAAENTEILHCTE      1 - 70
TICEKPSPGVNADFFKQLLELRKILFPKLVTTETGWLCLHSVALISRTFLSIYVAGLDGKIVKSIVEKKP     71 - 140
RTFIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQTYYKVINMDGRLANPDQSL    141 - 210
TEDIMMFSQSVAHLYSNLTKPILDVMLTSYTLIQTATSRGASPIGPTLLAGLVVYATAKVLKACSPKFGK    211 - 280
LVAEEAHRKGYLRYVHSRIIANVEEIAFYRGHKVEMKQLQKSYKALADQMNLILSKRLWYIMIEQFLMKY    281 - 350
VWSSSGLIMVAIPIITATGFADGEDGQKQVMVSERTEAFTTARNLLASGADAIERIMSSYKEVTELAGYT    351 - 420
ARVYNMFWVFDEVKRGIYKRTAVIQESESHSKNGAKVELPLSDTLAIKGKVIDVDHGIICENVPIITPAG    421 - 490
EVVASRLNFKVEEGMHLLITGPNGCGKSSLFRILSGLWPVYEGVLYKPPPQHMFYIPQRPYMSLGSLRDQ    491 - 560
VIYPDSVDDMHDKGYTDQDLERILHNVHLYHIVQREGGWDAVMDWKDVLSGGEKQRMGMARMFYHKPKYA    561 - 630
LLDECTSAVSIDVEGKIFQAAKGAGISLLSITHRPSLWKYHTHLLQFDGEGGWRFEQLDTAIRLTLSEEK    631 - 700
QKLESQLAGIPKMQQRLNELCKILGEDSVLKTIKNEDETS                                  701 - 740
//

Text Mined References (27)

PMID Year Title
25604068 2015 Duration of symptom and ABCD2 score as predictors of risk of early recurrent events after transient ischemic attack: a hospital-based case series study.
25079382 2014 Evaluation of retinoids for induction of the redundant gene ABCD2 as an alternative treatment option in X-linked adrenoleukodystrophy.
24338191 2013 Value of ABCD2 in predicting early ischemic stroke in patients diagnosed with transient ischemic attack.
23437103 2013 ABCD2 is a direct target of ?-catenin and TCF-4: implications for X-linked adrenoleukodystrophy therapy.
21145416 2011 Differential substrate specificities of human ABCD1 and ABCD2 in peroxisomal fatty acid ?-oxidation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20661612 2011 Identification of novel SNPs of ABCD1, ABCD2, ABCD3, and ABCD4 genes in patients with X-linked adrenoleukodystrophy (ALD) based on comprehensive resequencing and association studies with ALD phenotypes.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18834860 2008 X-linked adrenoleukodystrophy phenotype is independent of ABCD2 genotype.
18772397 2008 Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
More...