Property Summary

NCBI Gene PubMed Count 10
PubMed Score 81.99
PubTator Score 26.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 1.0e-05
juvenile dermatomyositis 1.041 8.9e-12
lung cancer -1.400 2.5e-04
medulloblastoma, large-cell -2.300 1.1e-05
osteosarcoma -1.209 1.6e-04
ovarian cancer -1.500 8.2e-07
spina bifida -1.258 3.6e-02

Synonym

Accession Q9UBI9 hHDC
Symbols HDC
HDCL
HHDC
dJ225E12.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MPNPKNSKGGRKNKRANSSGDEQENGAGALAAAGAAGAAAGGALAAAAGCGAAAAGAPGAGGAAGAGGAG      1 - 70
TGAANAAAAAGAAAAGDAKNEAPCATPLICSFGRPVDLEKDDYQKVVCNNEHCPCSTWMHLQCFYEWESS     71 - 140
ILVQFNCIGRARSWNEKQCRQNMWTKKGYDLAFRFCSCRCGQGHLKKDTDWYQVKRMQDEKKKKSGSEKN    141 - 210
TGRPPGEAAEEAKKCRPPNKPQKGPSHDLPRRHSMDRQNSQEKAVGAAAYGARSPGGSPGQSPPTGYSIL    211 - 280
SPAHFSGPRSSRYLGEFLKNAIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLS    281 - 350
ELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFL    351 - 420
SPSRHDEIEYDVPCHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQA    421 - 490
RLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVLEAY                     491 - 543
//

Text Mined References (12)

PMID Year Title