Property Summary

NCBI Gene PubMed Count 10
Grant Count 14
R01 Count 7
Funding $568,270.67
PubMed Score 75.42
PubTator Score 26.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.209 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -2.300 0.000
juvenile dermatomyositis 1.041 0.000
lung cancer -1.400 0.000
spina bifida -1.258 0.036
ovarian cancer -1.500 0.000

Gene RIF (5)

PMID Text
26356417 The Human Homolog of Drosophila Headcase Acts as a Tumor Suppressor through Its Blocking Effect on the Cell Cycle in Hepatocellular Carcinoma
22100912 HECA expression is markedly decreased in oral squamous cell carcinoma (OSCC) compared to controls and is associated with decreased sensitivity to cisplatin in OSCC cell lines
19643820 Human HECA slows down cell division of oral squamous cell carcinoma cells and may therefore act as a tumor suppressor in head and neck cancer.
19240061 Observational study of gene-disease association. (HuGE Navigator)
16525680 Data show that HECA may be an early-stage classifier of colorectal cancer that can discriminate between late- and early-stage disease.

AA Sequence

MPNPKNSKGGRKNKRANSSGDEQENGAGALAAAGAAGAAAGGALAAAAGCGAAAAGAPGAGGAAGAGGAG      1 - 70
TGAANAAAAAGAAAAGDAKNEAPCATPLICSFGRPVDLEKDDYQKVVCNNEHCPCSTWMHLQCFYEWESS     71 - 140
ILVQFNCIGRARSWNEKQCRQNMWTKKGYDLAFRFCSCRCGQGHLKKDTDWYQVKRMQDEKKKKSGSEKN    141 - 210
TGRPPGEAAEEAKKCRPPNKPQKGPSHDLPRRHSMDRQNSQEKAVGAAAYGARSPGGSPGQSPPTGYSIL    211 - 280
SPAHFSGPRSSRYLGEFLKNAIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLS    281 - 350
ELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFL    351 - 420
SPSRHDEIEYDVPCHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQA    421 - 490
RLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVLEAY                     491 - 543
//

Text Mined References (12)

PMID Year Title
26356417 2015 The Human Homolog of Drosophila Headcase Acts as a Tumor Suppressor through Its Blocking Effect on the Cell Cycle in Hepatocellular Carcinoma.
22100912 2012 The human HECA interacts with cyclins and CDKs to antagonize Wnt-mediated proliferation and chemoresistance of head and neck cancer cells.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19643820 2009 The human homolog of the Drosophila headcase protein slows down cell division of head and neck cancer cells.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16525680 2006 A homologue of the Drosophila headcase protein is a novel tumor marker for early-stage colorectal cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...