Property Summary

NCBI Gene PubMed Count 22
PubMed Score 1.92
PubTator Score 2.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
ependymoma 2514 1.40795580491452E-17
pilocytic astrocytoma 3086 5.69991568942994E-12
ovarian cancer 8492 5.1647199791059E-11
osteosarcoma 7933 8.68136632370772E-6
Breast cancer 3099 6.52898062837754E-5
glioblastoma 5572 6.55492293637649E-5
pediatric high grade glioma 2712 6.90941760944738E-5
psoriasis 6685 1.28198911968891E-4
ductal carcinoma in situ 1745 0.00156656415574335
invasive ductal carcinoma 2950 0.00179711023980215
diabetes mellitus 1663 0.00323611887867235
head and neck cancer 270 0.0106899224913761
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0108034611164252
Pick disease 1893 0.0208719879871284
mucosa-associated lymphoid tissue lymphoma 480 0.0278149303676181
subependymal giant cell astrocytoma 2287 0.0297086238312763

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.200 0.000
glioblastoma 1.700 0.000
osteosarcoma 2.761 0.000
ependymoma 1.800 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.011
diabetes mellitus -1.100 0.003
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 2.000 0.000
subependymal giant cell astrocytoma 1.958 0.030
Pick disease 1.200 0.021
Breast cancer -1.100 0.000
mucosa-associated lymphoid tissue lympho... 2.540 0.028
ductal carcinoma in situ -1.100 0.002
invasive ductal carcinoma -2.000 0.002
ovarian cancer -2.800 0.000
head and neck cancer -1.100 0.011

Synonym

Accession Q9UBI6 Q69YP5 Q9BRV5
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid

AA Sequence

MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI      1 - 70
IL                                                                         71 - 72
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023390 2013 Large-scale top-down proteomics of the human proteome: membrane proteins, mitochondria, and senescence.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
More...