Property Summary

NCBI Gene PubMed Count 22
PubMed Score 2.26
PubTator Score 2.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 1.9e-07
Breast cancer -1.100 6.5e-05
diabetes mellitus -1.100 3.2e-03
ductal carcinoma in situ -1.100 1.6e-03
ependymoma 1.200 2.6e-09
glioblastoma 1.300 7.2e-06
head and neck cancer -1.100 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.700 1.1e-02
invasive ductal carcinoma -1.700 3.2e-03
mucosa-associated lymphoid tissue lympho... 2.540 2.8e-02
osteosarcoma 2.761 8.7e-06
ovarian cancer -2.600 1.9e-10
pediatric high grade glioma 1.100 3.5e-05
Pick disease 1.200 2.1e-02
psoriasis -1.200 1.3e-04
subependymal giant cell astrocytoma 1.958 3.0e-02

AA Sequence

MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI      1 - 70
IL                                                                         71 - 72
//

Text Mined References (29)

PMID Year Title