Property Summary

NCBI Gene PubMed Count 22
PubMed Score 1.92
PubTator Score 2.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.200 0.000
glioblastoma 1.700 0.000
osteosarcoma 2.761 0.000
ependymoma 1.800 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.011
diabetes mellitus -1.100 0.003
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 2.000 0.000
subependymal giant cell astrocytoma 1.958 0.030
Pick disease 1.200 0.021
Breast cancer -1.100 0.000
mucosa-associated lymphoid tissue lympho... 2.540 0.028
ductal carcinoma in situ -1.100 0.002
invasive ductal carcinoma -2.000 0.002
ovarian cancer -2.800 0.000
head and neck cancer -1.100 0.011

Synonym

Accession Q9UBI6 Q69YP5 Q9BRV5
Symbols

Gene

AA Sequence

MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI      1 - 70
IL                                                                         71 - 72
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023390 2013 Large-scale top-down proteomics of the human proteome: membrane proteins, mitochondria, and senescence.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
More...