Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.89
PubTator Score 6.89

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.600 1.4e-03
atypical teratoid / rhabdoid tumor -1.300 8.0e-07
ependymoma -1.800 2.2e-03
glioblastoma -1.100 9.4e-06
group 3 medulloblastoma -1.300 6.6e-03
medulloblastoma, large-cell 1.100 2.6e-04
oligodendroglioma -1.200 1.3e-02
pediatric high grade glioma -1.100 3.4e-04
primitive neuroectodermal tumor -1.200 5.3e-03
psoriasis 1.700 2.0e-04

Gene RIF (2)

AA Sequence

MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGADVPQSWPSCLCHGLISFLGFLLLLVT      1 - 70
FPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLS     71 - 140
VGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRAWGL    141 - 210
EVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMAGGAPSPGPADTVEMVSEVEPPAPQV    211 - 280
GARSSPKQPLAEGLLTALQPFLSEALVSQVGACYQFNVVLPSGTQSAYFLDLTTGRGRVGHGVPDGIPDV    281 - 350
VVEMAEADLRALLCRELRPLGAYMSGRLKVKGDLAMAMKLEAVLRALK                          351 - 398
//

Text Mined References (12)

PMID Year Title