Property Summary

NCBI Gene PubMed Count 10
Grant Count 10
R01 Count 10
Funding $1,334,276
PubMed Score 5.24
PubTator Score 6.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.600 0.001
ependymoma -1.800 0.002
oligodendroglioma -1.200 0.013
psoriasis 1.700 0.000
glioblastoma -1.300 0.002
sonic hedgehog group medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.900 0.001
primitive neuroectodermal tumor -1.200 0.005
pediatric high grade glioma -1.100 0.000

Gene RIF (2)

PMID Text
21501885 [review] Stomatin family member STOML1 is oligomeric; it mostly localizes to membrane domains and has been shown to modulate ion channel activity.
19696025 Stomatin-like protein-1 interacts with stomatin and is targeted to late endosomes

AA Sequence

MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGADVPQSWPSCLCHGLISFLGFLLLLVT      1 - 70
FPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLS     71 - 140
VGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRAWGL    141 - 210
EVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMAGGAPSPGPADTVEMVSEVEPPAPQV    211 - 280
GARSSPKQPLAEGLLTALQPFLSEALVSQVGACYQFNVVLPSGTQSAYFLDLTTGRGRVGHGVPDGIPDV    281 - 350
VVEMAEADLRALLCRELRPLGAYMSGRLKVKGDLAMAMKLEAVLRALK                          351 - 398
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23082202 2012 The stomatin-like protein SLP-1 and Cdk2 interact with the F-Box protein Fbw7-?.
21501885 2012 Stomatin-domain proteins.
19696025 2009 Stomatin-like protein-1 interacts with stomatin and is targeted to late endosomes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10997330 2000 A novel gene STORP (STOmatin-Related Protein) is localized 2 kb upstream of the promyelocytic gene on chromosome 15q22.
More...