Property Summary

NCBI Gene PubMed Count 17
Grant Count 29
R01 Count 18
Funding $3,970,868.79
PubMed Score 93.69
PubTator Score 201.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
25938945 XPR1 mutations alter phosphate export and phosphate homeostasis in primary familial brain calcification.
20410264 These studies suggest that the expression of Xpr1 and certain genotypes of the RNASEL gene, which could restrict XMRV infection, may play important roles in defining XMRV tropisms in certain cell types.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKELAKIN      1 - 70
TFYSEKLAEAQRRFATLQNELQSSLDAQKESTGVTTLRQRRKPVFHLSHEERVQHRNIKDLKLAFSEFYL     71 - 140
SLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHVEVAPFYTCKKINQLISETEAVVTNELEDGD    141 - 210
RQKAMKRLRVPPLGAAQPAPAWTTFRVGLFCGIFIVLNITLVLAAVFKLETDRSIWPLIRIYRGGFLLIE    211 - 280
FLFLLGINTYGWRQAGVNHVLIFELNPRSNLSHQHLFEIAGFLGILWCLSLLACFFAPISVIPTYVYPLA    281 - 350
LYGFMVFFLINPTKTFYYKSRFWLLKLLFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSLE    351 - 420
LKWDESKGLLPNNSEESGICHKYTYGVRAIVQCIPAWLRFIQCLRRYRDTKRAFPHLVNAGKYSTTFFMV    421 - 490
TFAALYSTHKERGHSDTMVFFYLWIVFYIISSCYTLIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYY    491 - 560
CAIIEDVILRFAWTIQISITSTTLLPHSGDIIATVFAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDIS    561 - 630
VAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEANT        631 - 696
//

Text Mined References (24)

PMID Year Title
27230854 2016 XPR1 mutations are a rare cause of primary familial brain calcification.
27080106 2016 Control of eukaryotic phosphate homeostasis by inositol polyphosphate sensor domains.
26231937 2015 XPR1: a Gene Linked to Primary Familial Brain Calcification Might Help Explain a Spectrum of Neuropsychiatric Disorders.
25938945 2015 Mutations in XPR1 cause primary familial brain calcification associated with altered phosphate export.
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
23791524 2013 Inorganic phosphate export by the retrovirus receptor XPR1 in metazoans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22090134 2012 Xpr1 is an atypical G-protein-coupled receptor that mediates xenotropic and polytropic murine retrovirus neurotoxicity.
20410264 2010 Evaluation of cellular determinants required for in vitro xenotropic murine leukemia virus-related virus entry into human prostate cancer and noncancerous cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...