Property Summary

NCBI Gene PubMed Count 18
PubMed Score 97.26
PubTator Score 201.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 4.9e-04
atypical teratoid / rhabdoid tumor 1.900 7.5e-07
ductal carcinoma in situ 1.200 2.1e-02
ependymoma 2.000 1.6e-02
glioblastoma -1.400 7.5e-03
group 3 medulloblastoma 1.400 5.2e-04
intraductal papillary-mucinous adenoma (... -1.300 1.3e-02
juvenile dermatomyositis 1.025 5.7e-10
non-small cell lung cancer 1.432 2.7e-15
osteosarcoma 1.620 4.2e-03
ovarian cancer 1.200 4.4e-03
primitive neuroectodermal tumor 1.500 7.4e-04

Gene RIF (4)

AA Sequence

MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKELAKIN      1 - 70
TFYSEKLAEAQRRFATLQNELQSSLDAQKESTGVTTLRQRRKPVFHLSHEERVQHRNIKDLKLAFSEFYL     71 - 140
SLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHVEVAPFYTCKKINQLISETEAVVTNELEDGD    141 - 210
RQKAMKRLRVPPLGAAQPAPAWTTFRVGLFCGIFIVLNITLVLAAVFKLETDRSIWPLIRIYRGGFLLIE    211 - 280
FLFLLGINTYGWRQAGVNHVLIFELNPRSNLSHQHLFEIAGFLGILWCLSLLACFFAPISVIPTYVYPLA    281 - 350
LYGFMVFFLINPTKTFYYKSRFWLLKLLFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSLE    351 - 420
LKWDESKGLLPNNSEESGICHKYTYGVRAIVQCIPAWLRFIQCLRRYRDTKRAFPHLVNAGKYSTTFFMV    421 - 490
TFAALYSTHKERGHSDTMVFFYLWIVFYIISSCYTLIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYY    491 - 560
CAIIEDVILRFAWTIQISITSTTLLPHSGDIIATVFAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDIS    561 - 630
VAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEANT        631 - 696
//

Text Mined References (24)

PMID Year Title