Property Summary

NCBI Gene PubMed Count 62
Grant Count 8
Funding $317,731.5
PubMed Score 403.37
PubTator Score 62.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.900 0.000

Synonym

Accession Q9UBH0 A8K2I4 Q56AT9 Q7RTZ6 IL-36Ra
Symbols FIL1
FIL1D
IL1F5
IL1L1
PSORP
IL1HY1
IL1RP3
IL36RA
IL-36Ra
PSORS14
FIL1(DELTA)

Gene

PDB

4P0J   4P0K   4P0L  

Gene RIF (41)

PMID Text
26676204 The present study identified IL-36RN in various species and investigated the associations between IL-36RN and cancer prognosis.
26589685 generalized pustular psoriasis and early onset, ever generalized pustular psoriasis (more than two attacks), ever acrodermatitis continua of Hallopeau, inverse psoriasis, and a family history of pustular psoriasis were associated with IL36RN mutation.
25989471 IL36RN missense mutation was not associated with psoriasis.
25897967 IL36RN was identified as strong regulators of skin pathology in both lesional and non-lesional skin samples.
25688670 We identified a novel homozygous missense mutation in IL36RN in two siblings, and showed the molecular basis of the condition to be both distinct from psoriasis and distinct between the two families studied.
25615897 we report T123M and 115+6T>C mutations, both homozygous in nature, in two Japanese individuals with Zumbusch type of generalized pustular psoriasis.
25468355 identified a novel IL36RN missense mutation, c.334G > A in exon 5, that caused p.E112K substitution and was located adjacent to a 113 amino acid residue in generalized pustular psoriasis
25458002 The study found that IL36RN alleles define a generalized pustular psoriasis phenotype characterized by early onset, high risk of systemic inflammation, and low prevalence of psoriasis vulgaris.
25212972 found 2 new variants and 4 known IL36RN variants in 29 generalized pustular psoriasis patients
24979538 in a Chinese Daur family with generalized pustular psoriasis, identified a homozygous splice site mutation c.115+6T>C in intron 3 in both patients; other 4 family members and 7 healthy controls carried heterozygous c.115+6T>C mutations
More...

AA Sequence

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC      1 - 70
GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG     71 - 140
GWNAPITDFYFQQCD                                                           141 - 155
//

Text Mined References (63)

PMID Year Title
26676204 2016 Integrative genomic analysis of interleukin-36RN and its prognostic value in cancer.
26589685 2016 Correlation of IL36RN mutation with different clinical features of pustular psoriasis in Chinese patients.
25989471 2015 Palmoplantar Pustular Psoriasis Is Associated with Missense Variants in CARD14, but Not with Loss-of-Function Mutations in IL36RN in European Patients.
25897967 2015 Transcriptional landscape of psoriasis identifies the involvement of IL36 and IL36RN.
25688670 2016 A novel mutation in IL36RN underpins childhood pustular dermatosis.
25615897 2015 IL36RN gene analysis of two Japanese patients with generalized pustular psoriasis.
25468355 2014 Novel IL36RN gene mutation revealed by analysis of 8 Japanese patients with generalized pustular psoriasis.
25458002 2015 IL36RN mutations define a severe autoinflammatory phenotype of generalized pustular psoriasis.
25416956 2014 A proteome-scale map of the human interactome network.
25212972 2014 Mutation analysis of the IL36RN gene in Chinese patients with generalized pustular psoriasis with/without psoriasis vulgaris.
More...