Property Summary

NCBI Gene PubMed Count 6
Grant Count 8
R01 Count 1
Funding $408,624.33
PubMed Score 19.89
PubTator Score 55.38

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
16354684 P48 interacts with the RBP-L and RBP-J subunits primarily through two short conserved tryptophan-containing motifs, similar to the motif of the Notch intracellular domain (NotchIC) that interacts with RBP-J.
9111338 In mouse, there is cooperative transcriptional activity of RBP-L with EBNA-2.

AA Sequence

MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRCLQQQCEQTVR      1 - 70
ILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTVCGYMGLDSASGSATETQKLN     71 - 140
FEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRELGTFHSRLIKVISKPSQKKQSLKNTDLCIS    141 - 210
SGSKVSLFNRLRSQTVSTRYLSVEDGAFVASARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCT    211 - 280
VTGITLPPMIIRKVAKQCALLDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANR    281 - 350
ALLNDSSCWTIIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV    351 - 420
EAETMYRSPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYSVRPGHPGVPE    421 - 490
PATDADALLESIHQEFTRTNFHLFIQT                                               491 - 517
//

Text Mined References (6)

PMID Year Title
16354684 2006 PTF1 is an organ-specific and Notch-independent basic helix-loop-helix complex containing the mammalian Suppressor of Hairless (RBP-J) or its paralogue, RBP-L.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9929984 1999 Chromosomal mapping of two RBP-J-related genes: Kyo-T and RBP-L.
9111338 1997 RBP-L, a transcription factor related to RBP-Jkappa.