Property Summary

NCBI Gene PubMed Count 6
PubMed Score 33.09
PubTator Score 55.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UBG7 O95723 Q5QPU9 Q5QPV0 Q9ULV9
Symbols RBPL
SUHL
RBPSUHL

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRCLQQQCEQTVR      1 - 70
ILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTVCGYMGLDSASGSATETQKLN     71 - 140
FEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRELGTFHSRLIKVISKPSQKKQSLKNTDLCIS    141 - 210
SGSKVSLFNRLRSQTVSTRYLSVEDGAFVASARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCT    211 - 280
VTGITLPPMIIRKVAKQCALLDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANR    281 - 350
ALLNDSSCWTIIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV    351 - 420
EAETMYRSPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYSVRPGHPGVPE    421 - 490
PATDADALLESIHQEFTRTNFHLFIQT                                               491 - 517
//

Text Mined References (6)

PMID Year Title