Property Summary

NCBI Gene PubMed Count 20
Grant Count 4
R01 Count 3
Funding $310,320.25
PubMed Score 27.94
PubTator Score 24.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma -5.100 0.019
lung cancer -4.700 0.022
cystic fibrosis 1.500 0.008
nasopharyngeal carcinoma -1.900 0.001
spina bifida -1.950 0.043

Gene RIF (8)

PMID Text
24263008 Loss of CRNN expression correlated with advanced tumor length, greater tumor invasion depth, lymph node metastasis, and poor survival in patients with esophageal squamous cell carcinoma.
23894350 Findings demonstrate that CRNN is a tumor suppressor gene that plays a critical tumor suppressive role in ESCC.
22560086 cornulin is an important molecule in normal esophageal pathology and is likely lost during the conversion of normal to neoplastic epithelium
20412117 Negative regulation of SIRT1 by DBC1 may retard tumorigenesis in breast tissue, so the correlation between SIRT1 and DBC1 is a potential prognostic indicator in breast cancer.
19558548 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19133922 CRNN mRNA expression is decreased in eczematous skin
18465210 Results describe the cloning of porcine SEP53, its homology to the human protein, and its expression in the esophagus and in gastric squamous epithelium.
17925851 SEP53 may be a component of the mucosal/epithelial innate immune response engaged in an ongoing interaction with a pathogen

AA Sequence

MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRLLDEDHTGTVE      1 - 70
FKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSGTEVGRAGKGQHYEGSSHRQS     71 - 140
QQGSRGQNRPGVQTQGQATGSAWVSSYDRQAESQSQERISPQIQLSGQTEQTQKAGEGKRNQTTEMRPER    141 - 210
QPQTREQDRAHQTGETVTGSGTQTQAGATQTVEQDSSHQTGRTSKQTQEATNDQNRGTETHGQGRSQTSQ    211 - 280
AVTGGHAQIQAGTHTQTPTQTVEQDSSHQTGSTSTQTQESTNGQNRGTEIHGQGRSQTSQAVTGGHTQIQ    281 - 350
AGSHTETVEQDRSQTVSHGGAREQGQTQTQPGSGQRWMQVSNPEAGETVPGGQAQTGASTESGRQEWSST    351 - 420
HPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYL    421 - 490
RSTKP                                                                     491 - 495
//

Text Mined References (27)

PMID Year Title
24263008 2014 Loss of CRNN expression is associated with advanced tumor stage and poor survival in patients with esophageal squamous cell carcinoma.
23894350 2013 Characterization of tumor suppressive function of cornulin in esophageal squamous cell carcinoma.
23568457 2013 Genetic variants associated with disordered eating.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22560086 2013 Downregulation of cornulin in esophageal squamous cell carcinoma.
20412117 2010 Balance between SIRT1 and DBC1 expression is lost in breast cancer.
19558548 2009 Genetic variants of C1orf10 and risk of esophageal squamous cell carcinoma in a Chinese population.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19133922 2009 Cornulin, a marker of late epidermal differentiation, is down-regulated in eczema.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...