Property Summary

NCBI Gene PubMed Count 36
PubMed Score 80.26
PubTator Score 62.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
limb-girdle muscular dystrophy 37 0.0 4.0
Disease Target Count Z-score Confidence
Glycogen storage disease IV 6 3.094 1.5

Expression

  Differential Expression (3)

Gene RIF (19)

AA Sequence

MFNYERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSSHITMSSSAFP      1 - 70
ASPKQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAK     71 - 140
PIPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLTYEEKMARRLLGPQNAAAVFQAQDDSGAQDS    141 - 210
QQHNSEHARLQVPTSQVRSRSTSRGDVNDQDAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPD    211 - 280
VSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPM    281 - 350
FIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGW    351 - 420
YTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQS    421 - 490
GLYESEEL                                                                  491 - 498
//

Text Mined References (37)

PMID Year Title