Property Summary

NCBI Gene PubMed Count 47
Grant Count 10
R01 Count 7
Funding $1,041,974.98
PubMed Score 67.39
PubTator Score 40.85

Knowledge Summary

Patent (3,967)

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.200 0.011
oligodendroglioma 1.300 0.002
psoriasis 1.600 0.000
osteosarcoma -1.273 0.000
astrocytoma 1.100 0.044
ovarian cancer 1.700 0.000

Gene RIF (25)

PMID Text
25410869 Although human rhinovirus 3A protein was previously shown to interact with ACBD3, these data suggest that PI4KIIIbeta recruitment occurred independently of both GBF1 and ACBD3.
24962317 PI4KIIIbeta likely plays a role in breast oncogenesis and that cooperation between Rab11a and PI4KIIIbeta represents a novel Akt activation pathway.
24876499 these data provide a mechanism for how PI4KIIIbeta coordinates Rab11 and its effectors on PI4P-enriched membranes and also provide strategies for the design of specific inhibitors that could potentially target plasmodial PI4KIIIbeta to combat malaria.
24792752 Authors found that NS5A and PI4KB competed for association of acyl-coenzyme A binding domain containing protein 3 (ACBD3), which inhibited hepatitis C virus replication.
24672044 Host ACBD3, PI4KIIIBETA and Aichi virus proteins complexes enhances phosphatidylinositol 4-phosphate synthesis and is critical for viral replication.
24527995 These results suggest that poliovirus proteins modulate PI4KB activity and provide PI4P for recruitment of OSBP to accumulate unesterified cholesterol on virus-induced membrane structure for formation of a virus replication complex.
23258225 The lipid kinase PI4KIIIbeta preserves lysosomal identity.
22359663 During authentic HCV infection, PI4P plays an integral role in virus replication; the vesicular transport proteins ARF1 and GBF1 colocalized with PI4KIIIbeta and were both required for HCV replication.
22258260 The 3A protein of picornaviruses utilizes the golgi adaptor protein ACBD3 to recruit PI4KIIIbeta.
22253445 Phosphatidylinositol 4-kinase IIIbeta is required for severe acute respiratory syndrome coronavirus spike-mediated cell entry.
More...

AA Sequence

MGDTVVEPAPLKPTSEPTSGPPGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVKLLHGGVAVSS      1 - 70
RGTPLELVNGDGVDSEIRCLDDPPAQIREEEDEMGAAVASGTAKGARRRRQNNSAKQSWLLRLFESKLFD     71 - 140
ISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQLLNMYIHMDEDVGDAIKPYIVHRCRQSINFSL    141 - 210
QCALLLGAYSSDMHISTQRHSRGTKLRKLILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDAT    211 - 280
ASISLSSNLKRTASNPKVENEDEELSSSTESIDNSFSSPVRLAPEREFIKSLMAIGKRLATLPTKEQKTQ    281 - 350
RLISELSLLNHKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTSVPARIPE    351 - 420
NRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVELPEVHTNSCDNISQFSVDSI    421 - 490
TSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLS    491 - 560
VIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSL    561 - 630
LDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRN    631 - 700
LGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIR    701 - 770
NLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM                            771 - 816
//

Text Mined References (56)

PMID Year Title
25410869 2015 GBF1- and ACBD3-independent recruitment of PI4KIII? to replication sites by rhinovirus 3A proteins.
24962317 2014 The lipid kinase PI4KIII? is highly expressed in breast tumors and activates Akt in cooperation with Rab11a.
24876499 2014 Structures of PI4KIII? complexes show simultaneous recruitment of Rab11 and its effectors.
24792752 2014 Hepatitis C virus NS5A competes with PI4KB for binding to ACBD3 in a genotype-dependent manner.
24672044 2014 A complex comprising phosphatidylinositol 4-kinase III?, ACBD3, and Aichi virus proteins enhances phosphatidylinositol 4-phosphate synthesis and is critical for formation of the viral replication complex.
24527995 2014 Phosphatidylinositol-4 kinase III beta and oxysterol-binding protein accumulate unesterified cholesterol on poliovirus-induced membrane structure.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24008843 2013 Structure homology and interaction redundancy for discovering virus-host protein interactions.
23572552 2013 ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding.
More...